SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9UDX5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q9UDX5
Domain Number - Region: 88-116
Classification Level Classification E-value
Superfamily Thiolase-like 0.0115
Family Chalcone synthase-like 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9UDX5
Sequence length 166
Comment (sp|Q9UDX5|MTFP1_HUMAN) Mitochondrial 18 kDa protein KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=MTFP1; OC=Catarrhini; Hominidae; Homo.
Sequence
MSEPQPRGAERDLYRDTWVRYLGYANEVGEAFRSLVPAAVVWLSYGVASSYVLADAIDKG
KKAGEVPSPEAGRSARVTVAVVDTFVWQALASVAIPGFTINRVCAASLYVLGTATRWPLA
VRKWTTTALGLLTIPIIIHPIDRSVDFLLDSSLRKLYPTVGKPSSS
Download sequence
Identical sequences A0A024R1E4 G3RAB5 H2QZM0 Q9UDX5
ENSPTRP00000039193 ENSP00000266263 gi|51243055|ref|NP_057582.2| ENSP00000266263 ENSGGOP00000012381 9598.ENSPTRP00000039193 9606.ENSP00000266263 ENSPTRP00000039193 NP_057582.2.87134 NP_057582.2.92137 XP_003317233.1.37143 XP_003812069.1.60992 XP_004063323.1.27298 HR6552 ENSGGOP00000012381 ENSP00000266263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]