SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9UGQ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9UGQ3
Domain Number 1 Region: 24-359,398-495
Classification Level Classification E-value
Superfamily MFS general substrate transporter 4.05e-58
Family Glycerol-3-phosphate transporter 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9UGQ3
Sequence length 507
Comment (sp|Q9UGQ3|GTR6_HUMAN) Glucose transporter type 9 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=SLC2A6; OC=Catarrhini; Hominidae; Homo.
Sequence
MQEPLLGAEGPDYDTFPEKPPPSPGDRARVGTLQNKRVFLATFAAVLGNFSFGYALVYTS
PVIPALERSLDPDLHLTKSQASWFGSVFTLGAAAGGLSAMILNDLLGRKLSIMFSAVPSA
AGYALMAGAHGLWMLLLGRTLTGFAGGLTAACIPVYVSEIAPPGVRGALGATPQLMAVFG
SLSLYALGLLLPWRWLAVAGEAPVLIMILLLSFMPNSPRFLLSRGRDEEALRALAWLRGT
DVDVHWEFEQIQDNVRRQSSRVSWAEARAPHVCRPITVALLMRLLQQLTGITPILVYLQS
IFDSTAVLLPPKDDAAIVGAVRLLSVLIAALTMDLAGRKVLLFVSAAIMFAANLTLGLYI
HFGPRPLSPNSTAGLESESWGDLAQPLAAPAGYLTLVPLLATMLFIMGYAVGWGPITWLL
MSEVLPLRARGVASGLCVLASWLTAFVLTKSFLPVVSTFGLQVPFFFFAAICLVSLVFTG
CCVPETKGRSLEQIESFFRTGRRSFLR
Download sequence
Identical sequences Q9UGQ3
ENSP00000360966 ENSP00000457648 ENSP00000360964 ENSP00000455415 ENSP00000360966 NP_060055.2.87134 NP_060055.2.92137 gi|223029432|ref|NP_060055.2| 9606.ENSP00000360966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]