SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9UHQ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9UHQ1
Domain Number 1 Region: 52-64,92-443
Classification Level Classification E-value
Superfamily Fe-only hydrogenase 1.7e-110
Family Fe-only hydrogenase 0.0000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9UHQ1
Sequence length 456
Comment (sp|Q9UHQ1|NARF_HUMAN) Iron-only hydrogenase-like protein 2 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=NARF; OC=Catarrhini; Hominidae; Homo.
Sequence
MKCEHCTRKECSKKTKTDDQENVSADAPSPAQENGEKGEFHKLADAKIFLSDCLACDSCM
TAEEGVQLSQQNAKDFFRVLNLNKKCDTSKHKVLVVSVCPQSLPYFAAKFNLSVTDASRR
LCGFLKSLGVHYVFDTTIAADFSILESQKEFVRRYRQHSEEERTLPMLTSACPGWVRYAE
RVLGRPITAHLCTAKSPQQVMGSLVKDYFARQQNLSPEKIFHVIVAPCYDKKLEALQESL
PPALHGSRGADCVLTSGEIAQIMEQGDLSVRDAAVDTLFGDLKEDKVTRHDGASSDGHLA
HIFRHAAKELFNEDVEEVTYRALRNKDFQEVTLEKNGEVVLRFAAAYGFRNIQNMILKLK
KGKFPFHFVEVLACAGGCLNGRGQAQTPDGHADKALLRQMEGIYADIPVRRPESSAHVQE
LYQEWLEGINSPKAREVLHTTYQSQERGTHSLDIKW
Download sequence
Identical sequences Q9UHQ1
ENSP00000309899 9606.ENSP00000309899 gi|6912524|ref|NP_036468.1| NYSGRC-6912524 NP_036468.1.87134 NP_036468.1.92137 ENSP00000309899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]