SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9UID6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9UID6
Domain Number 1 Region: 397-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000318
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 2 Region: 241-298
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000587
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 3 Region: 203-255
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000168
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 4 Region: 283-335
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000569
Family Classic zinc finger, C2H2 0.034
Further Details:      
 
Weak hits

Sequence:  Q9UID6
Domain Number - Region: 429-482
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000268
Family Classic zinc finger, C2H2 0.031
Further Details:      
 
Domain Number - Region: 372-412
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00129
Family Classic zinc finger, C2H2 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9UID6
Sequence length 485
Comment (sp|Q9UID6|ZN639_HUMAN) Zinc finger protein ZASC1 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ZNF639; OC=Catarrhini; Hominidae; Homo.
Sequence
MNEYPKKRKRKTLHPSRYSDSSGISRIADGFNGIFSDHCYSVCSMRQPDLKYFDNKDDDS
DTETSNDLPKFADGIKARNRNQNYLVPSPVLRILDHTAFSTEKSADIVICDEECDSPESV
NQQTQEESPIEVHTAEDVPIAVEVHAISEDYDIETENNSSESLQDQTDEEPPAKLCKILD
KSQALNVTAQQKWPLLRANSSGLYKCELCEFNSKYFSDLKQHMILKHKRTDSNVCRVCKE
SFSTNMLLIEHAKLHEEDPYICKYCDYKTVIFENLSQHIADTHFSDHLYWCEQCDVQFSS
SSELYLHFQEHSCDEQYLCQFCEHETNDPEDLHSHVVNEHACKLIELSDKYNNGEHGQYS
LLSKITFDKCKNFFVCQVCGFRSRLHTNVNRHVAIEHTKIFPHVCDDCGKGFSSMLEYCK
HLNSHLSEGIYLCQYCEYSTGQIEDLKIHLDFKHSADLPHKCSDCLMRFGNERELISHLP
VHETT
Download sequence
Identical sequences Q9UID6
NP_001290354.1.87134 NP_001290354.1.92137 NP_001290355.1.87134 NP_001290355.1.92137 NP_057415.1.87134 NP_057415.1.92137 XP_016862039.1.92137 XP_016862040.1.92137 XP_016862041.1.92137 XP_016862042.1.92137 gi|7705935|ref|NP_057415.1| ENSP00000325634 ENSP00000417740 ENSP00000418766 ENSP00000477626 9606.ENSP00000325634 ENSP00000325634 ENSP00000325634 ENSP00000417740 ENSP00000418766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]