SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9UIM3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9UIM3
Domain Number 1 Region: 208-339
Classification Level Classification E-value
Superfamily TPR-like 6.27e-28
Family Tetratricopeptide repeat (TPR) 0.0043
Further Details:      
 
Domain Number 2 Region: 95-181
Classification Level Classification E-value
Superfamily FKBP-like 0.0000000271
Family FKBP immunophilin/proline isomerase 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9UIM3
Sequence length 349
Comment (sp|Q9UIM3|FKBPL_HUMAN) WAF-1/CIP1 stabilizing protein 39 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=FKBPL; OC=Catarrhini; Hominidae; Homo.
Sequence
METPPVNTIGEKDTSQPQQEWEKNLRENLDSVIQIRQQPRDPPTETLELEVSPDPASQIL
EHTQGAEKLVAELEGDSHKSHGSTSQMPEALQASDLWYCPDGSFVKKIVIRGHGLDKPKL
GSCCRVLALGFPFGSGPPEGWTELTMGVGPWREETWGELIEKCLESMCQGEEAELQLPGH
SGPPVRLTLASFTQGRDSWELETSEKEALAREERARGTELFRAGNPEGAARCYGRALRLL
LTLPPPGPPERTVLHANLAACQLLLGQPQLAAQSCDRVLEREPGHLKALYRRGVAQAALG
NLEKATADLKKVLAIDPKNRAAQEELGKVVIQGKNQDAGLAQGLRKMFG
Download sequence
Identical sequences A0A024RCQ6 Q9UIM3
ENSP00000364298 ENSP00000397530 ENSP00000398812 9606.ENSP00000364298 9606.ENSP00000397530 9606.ENSP00000398812 gi|17149853|ref|NP_071393.2| ENSP00000364298 ENSP00000397530 ENSP00000398812 ENSP00000364298 ENSP00000397530 ENSP00000398812 NP_071393.2.87134 NP_071393.2.92137 399908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]