SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9UKL0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9UKL0
Domain Number 1 Region: 180-239
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000201
Family Myb/SANT domain 0.0026
Further Details:      
 
Domain Number 2 Region: 381-441
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000495
Family Myb/SANT domain 0.0000805
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9UKL0
Sequence length 485
Comment (sp|Q9UKL0|RCOR1_HUMAN) Protein CoREST KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=RCOR1; OC=Catarrhini; Hominidae; Homo.
Sequence
MPAMVEKGPEVSGKRRGRNNAAASASAAAASAAASAACASPAATAASGAAASSASAAAAS
AAAAPNNGQNKSLAAAAPNGNSSSNSWEEGSSGSSSDEEHGGGGMRVGPQYQAVVPDFDP
AKLARRSQERDNLGMLVWSPNQNLSEAKLDEYIAIAKEKHGYNMEQALGMLFWHKHNIEK
SLADLPNFTPFPDEWTVEDKVLFEQAFSFHGKTFHRIQQMLPDKSIASLVKFYYSWKKTR
TKTSVMDRHARKQKREREESEDELEEANGNNPIDIEVDQNKESKKEVPPTETVPQVKKEK
HSTQAKNRAKRKPPKGMFLSQEDVEAVSANATAATTVLRQLDMELVSVKRQIQNIKQTNS
ALKEKLDGGIEPYRLPEVIQKCNARWTTEEQLLAVQAIRKYGRDFQAISDVIGNKSVVQV
KNFFVNYRRRFNIDEVLQEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEEDEAPVLDVR
YASAS
Download sequence
Identical sequences Q9UKL0
NP_055971.2.87134 NP_055971.2.92137 ENSP00000262241 ENSP00000262241 ENSP00000459789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]