SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9UKQ2 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9UKQ2
Domain Number 1 Region: 202-397
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.57e-68
Family Reprolysin-like 0.00000976
Further Details:      
 
Domain Number 2 Region: 416-490
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 2.09e-21
Family Blood coagulation inhibitor (disintegrin) 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
cell surface 1.3 10.4
neuron projection terminus 2.125 9.05
exocytic vesicle 2.03 8.34
Golgi-associated vesicle 2.091 6.62
vacuolar part 1.567 6.28
dendrite 1.582 5.69
host cell part 1.996 5.41
lysosomal membrane 1.946 5.05
endocytic vesicle 1.532 4.85
cytoplasmic vesicle part 1.417 4.7
Molecular Function IC (bits) H-Score
metallopeptidase activity 2.054 168.98
endopeptidase activity 1.571 151.3
zinc ion binding 1.527 42.04
cytokine receptor binding 1.974 16.02
growth factor receptor binding 2.188 16.02
enzyme activator activity 1.431 14.69
integrin binding 1.56 12.29
peptide transporter activity 1.665 9.96
amide binding 1.538 9.47
protein kinase binding 1.492 9.19

Protein sequence

External link(s) Q9UKQ2
Sequence length 775
Comment (sp|Q9UKQ2|ADA28_HUMAN) Metalloproteinase-like, disintegrin-like, and cysteine-rich protein L KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ADAM28; OC=Catarrhini; Hominidae; Homo.
Sequence
MLQGLLPVSLLLSVAVSAIKELPGVKKYEVVYPIRLHPLHKREAKEPEQQEQFETELKYK
MTINGKIAVLYLKKNKNLLAPGYTETYYNSTGKEITTSPQIMDDCYYQGHILNEKVSDAS
ISTCRGLRGYFSQGDQRYFIEPLSPIHRDGQEHALFKYNPDEKNYDSTCGMDGVLWAHDL
QQNIALPATKLVKLKDRKVQEHEKYIEYYLVLDNGEFKRYNENQDEIRKRVFEMANYVNM
LYKKLNTHVALVGMEIWTDKDKIKITPNASFTLENFSKWRGSVLSRRKRHDIAQLITATE
LAGTTVGLAFMSTMCSPYSVGVVQDHSDNLLRVAGTMAHEMGHNFGMFHDDYSCKCPSTI
CVMDKALSFYIPTDFSSCSRLSYDKFFEDKLSNCLFNAPLPTDIISTPICGNQLVEMGED
CDCGTSEECTNICCDAKTCKIKATFQCALGECCEKCQFKKAGMVCRPAKDECDLPEMCNG
KSGNCPDDRFQVNGFPCHHGKGHCLMGTCPTLQEQCTELWGPGTEVADKSCYNRNEGGSK
YGYCRRVDDTLIPCKANDTMCGKLFCQGGSDNLPWKGRIVTFLTCKTFDPEDTSQEIGMV
ANGTKCGDNKVCINAECVDIEKAYKSTNCSSKCKGHAVCDHELQCQCEEGWIPPDCDDSS
VVFHFSIVVGVLFPMAVIFVVVAMVIRHQSSREKQKKDQRPLSTTGTRPHKQKRKPQMVK
AVQPQEMSQMKPHVYDLPVEGNEPPASFHKDTNALPPTVFKDNPVSTPKDSNPKA
Download sequence
Identical sequences Q9UKQ2
ENSP00000265769 gi|98985828|ref|NP_055080.2| ENSP00000265769 ENSP00000265769 9606.ENSP00000265769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]