SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9UM01 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9UM01
Sequence length 511
Comment (sp|Q9UM01|YLAT1_HUMAN) y(+)L-type amino acid transporter 1 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=SLC7A7; OC=Catarrhini; Hominidae; Homo.
Sequence
MVDSTEYEVASQPEVETSPLGDGASPGPEQVKLKKEISLLNGVCLIVGNMIGSGIFVSPK
GVLIYSASFGLSLVIWAVGGLFSVFGALCYAELGTTIKKSGASYAYILEAFGGFLAFIRL
WTSLLIIEPTSQAIIAITFANYMVQPLFPSCFAPYAASRLLAAACICLLTFINCAYVKWG
TLVQDIFTYAKVLALIAVIVAGIVRLGQGASTHFENSFEGSSFAVGDIALALYSALFSYS
GWDTLNYVTEEIKNPERNLPLSIGISMPIVTIIYILTNVAYYTVLDMRDILASDAVAVTF
ADQIFGIFNWIIPLSVALSCFGGLNASIVAASRLFFVGSREGHLPDAICMIHVERFTPVP
SLLFNGIMALIYLCVEDIFQLINYYSFSYWFFVGLSIVGQLYLRWKEPDRPRPLKLSVFF
PIVFCLCTIFLVAVPLYSDTINSLIGIAIALSGLPFYFLIIRVPEHKRPLYLRRIVGSAT
RYLQVLCMSVAAEMDLEDGGEMPKQRDPKSN
Download sequence
Identical sequences A0A0S2Z502 G3QM98 H2Q7Z2 Q9UM01
ENSP00000285850 ENSP00000380662 ENSP00000380663 ENSP00000380666 ENSP00000451881 ENSPTRP00000010414 ENSP00000285850 ENSGGOP00000003633 9598.ENSPTRP00000010414 9606.ENSP00000285850 ENSP00000285850 ENSP00000380662 ENSP00000380663 ENSP00000380666 ENSP00000451881 gi|186910304|ref|NP_003973.3| gi|186910306|ref|NP_001119577.1| gi|186910308|ref|NP_001119578.1| ENSGGOP00000003633 ENSPTRP00000010414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]