SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9UM01 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9UM01
Sequence length 511
Comment (sp|Q9UM01|YLAT1_HUMAN) y(+)L-type amino acid transporter 1 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=SLC7A7; OC=Catarrhini; Hominidae; Homo.
Sequence
MVDSTEYEVASQPEVETSPLGDGASPGPEQVKLKKEISLLNGVCLIVGNMIGSGIFVSPK
GVLIYSASFGLSLVIWAVGGLFSVFGALCYAELGTTIKKSGASYAYILEAFGGFLAFIRL
WTSLLIIEPTSQAIIAITFANYMVQPLFPSCFAPYAASRLLAAACICLLTFINCAYVKWG
TLVQDIFTYAKVLALIAVIVAGIVRLGQGASTHFENSFEGSSFAVGDIALALYSALFSYS
GWDTLNYVTEEIKNPERNLPLSIGISMPIVTIIYILTNVAYYTVLDMRDILASDAVAVTF
ADQIFGIFNWIIPLSVALSCFGGLNASIVAASRLFFVGSREGHLPDAICMIHVERFTPVP
SLLFNGIMALIYLCVEDIFQLINYYSFSYWFFVGLSIVGQLYLRWKEPDRPRPLKLSVFF
PIVFCLCTIFLVAVPLYSDTINSLIGIAIALSGLPFYFLIIRVPEHKRPLYLRRIVGSAT
RYLQVLCMSVAAEMDLEDGGEMPKQRDPKSN
Download sequence
Identical sequences A0A0S2Z502 G3QM98 H2Q7Z2 Q9UM01
ENSGGOP00000003633 ENSPTRP00000010414 gi|186910304|ref|NP_003973.3| gi|186910306|ref|NP_001119577.1| gi|186910308|ref|NP_001119578.1| ENSPTRP00000010414 ENSP00000285850 ENSP00000285850 ENSP00000380662 ENSP00000380663 ENSP00000380666 ENSP00000451881 ENSP00000285850 ENSP00000380662 ENSP00000380663 ENSP00000380666 ENSP00000451881 NP_001119577.1.87134 NP_001119577.1.92137 NP_001119578.1.87134 NP_001119578.1.92137 XP_004054957.1.27298 XP_004054958.1.27298 XP_006720365.1.92137 XP_009425741.1.37143 XP_011535600.1.92137 XP_011535601.1.92137 XP_016781347.1.37143 XP_016781348.1.37143 XP_016781349.1.37143 XP_016781350.1.37143 XP_018865275.1.27298 XP_018865276.1.27298 XP_018865277.1.27298 XP_018865278.1.27298 XP_018865280.1.27298 XP_018865281.1.27298 XP_018865282.1.27298 XP_018865283.1.27298 XP_018865284.1.27298 ENSGGOP00000003633 9598.ENSPTRP00000010414 9606.ENSP00000285850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]