SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9UNE2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9UNE2
Domain Number 1 Region: 46-165
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 9.42e-35
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9UNE2
Sequence length 315
Comment (sp|Q9UNE2|RPH3L_HUMAN) Rabphilin-3A-like protein KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=RPH3AL; OC=Catarrhini; Hominidae; Homo.
Sequence
MADTIFGSGNDQWVCPNDRQLALRAKLQTGWSVHTYQTEKQRRKQHLSPAEVEAILQVIQ
RAERLDVLEQQRIGRLVERLETMRRNVMGNGLSQCLLCGEVLGFLGSSSVFCKDCRKKVC
TKCGIEASPGQKRPLWLCKICSEQREVWKRSGAWFYKGLPKYILPLKTPGRADDPHFRPL
PTEPAEREPRSSETSRIYTWARGRVVSSDSDSDSDLSSSSLEDRLPSTGVRDRKGDKPWK
ESGGSVEAPRMGFTHPPGHLSGCQSSLASGETGTGSADPPGGPRPGLTRRAPVKDTPGRA
PAADAAPAGPSSCLG
Download sequence
Identical sequences Q9UNE2
ENSP00000328977 ENSP00000479485 ENSP00000483035 gi|298676510|ref|NP_001177340.1| gi|5902064|ref|NP_008918.1| ENSP00000319210 ENSP00000459238 ENSP00000328977 ENSP00000469361 ENSP00000476929 9606.ENSP00000319210 NP_001177340.1.87134 NP_001177340.1.92137 NP_008918.1.87134 NP_008918.1.92137 XP_011533669.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]