SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9UNX3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9UNX3
Domain Number 1 Region: 8-125
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 5.57e-37
Family Ribosomal proteins L24p and L21e 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9UNX3
Sequence length 145
Comment (sp|Q9UNX3|RL26L_HUMAN) Large ribosomal subunit protein uL24-like 1 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=RPL26L1; OC=Catarrhini; Hominidae; Homo.
Sequence
MKFNPFVTSDRSKNRKRHFNAPSHVRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRG
HYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIHPSKVVITRLKLDKDRKKILE
RKAKSRQVGKEKGKYKEELIEKMQE
Download sequence
Identical sequences A0A212C8C1 A0A2J8X7G8 A0A2K5EJ17 A0A2K5LCG0 A0A2K5Q1C3 A0A2K6BHY7 A0A2K6F7L7 A0A2K6TTH1 F2Z5N5 F6V6Z8 F7GC20 G3SYV7 G7P6X1 I3MZT8 K7D1B0 L8IE86 Q9UNX3 W5P1J6
ENSPVAP00000003071 9361.ENSDNOP00000016718 9544.ENSMMUP00000004097 9598.ENSPTRP00000029952 9606.ENSP00000265100 9685.ENSFCAP00000010458 9823.ENSSSCP00000017999 9986.ENSOCUP00000020523 ENSOCUP00000020523 ENSFCAP00000010458 ENSP00000265100 ENSP00000428177 ENSP00000428223 ENSP00000430147 ENSTTRP00000010068 ENSPCAP00000002071 ENSCJAP00000035706 ENSTTRP00000010068 ENSCJAP00000035706 ENSMMUP00000004097 ENSSTOP00000017634 ENSPVAP00000003071 NP_001253942.1.72884 NP_001304909.1.87134 NP_001304909.1.92137 NP_001304910.1.87134 NP_001304910.1.92137 NP_001304911.1.87134 NP_001304911.1.92137 NP_057177.1.87134 NP_057177.1.92137 XP_001154101.1.37143 XP_002710426.3.1745 XP_002744619.1.60252 XP_003404708.1.64505 XP_004272054.1.21590 XP_004315025.1.83887 XP_004371248.1.4749 XP_004679281.1.23501 XP_005334175.1.77405 XP_005558594.1.63531 XP_005558595.1.63531 XP_005899835.1.15283 XP_005982892.1.78601 XP_006864869.1.41390 XP_006884416.1.29581 XP_006906579.2.64745 XP_006906580.1.64745 XP_007082857.1.5354 XP_007082858.1.5354 XP_007190374.1.59432 XP_007949843.1.48129 XP_008964846.1.60992 XP_008964847.1.60992 XP_008964848.1.60992 XP_009448407.1.37143 XP_009448408.1.37143 XP_010344951.1.74449 XP_010590875.1.64505 XP_010590881.1.64505 XP_010849598.1.44457 XP_011283735.1.62641 XP_011369278.1.92234 XP_011369280.1.92234 XP_011532867.1.92137 XP_011738385.1.29376 XP_011738386.1.29376 XP_011906417.1.92194 XP_011906418.1.92194 XP_012383096.1.11602 XP_012389290.1.21590 XP_012505171.1.63892 XP_012505172.1.63892 XP_012505173.1.63892 XP_012505174.1.63892 XP_012620954.1.48125 XP_012620955.1.48125 XP_014706336.1.49734 XP_014706337.1.49734 XP_014928178.1.86478 XP_014928179.1.86478 XP_014928180.1.86478 XP_014996882.1.72884 XP_015348098.1.40921 XP_015393243.1.5354 XP_015440643.1.64745 XP_016000590.1.101085 XP_016066725.1.3490 XP_016865008.1.92137 XP_016865009.1.92137 XP_017403155.1.71028 XP_019305874.1.44245 XP_019305876.1.44245 XP_019305877.1.44245 XP_019491497.1.44202 XP_019491498.1.44202 XP_019596910.1.88060 XP_019596920.1.88060 XP_019596929.1.88060 XP_019694422.1.62641 XP_019694424.1.62641 XP_019694428.1.62641 XP_020039171.1.5219 XP_020765809.1.74333 XP_021527910.1.9421 ENSPCAP00000002071 ENSOARP00000004295 gi|7705813|ref|NP_057177.1| ENSMMUP00000004097 ENSSTOP00000017634 ENSDNOP00000016718 ENSSSCP00000017999 ENSLAFP00000005713 ENSSSCP00000017999 ENSLAFP00000005713 ENSP00000265100 ENSFCAP00000020832 ENSP00000265100 ENSP00000428177 ENSP00000428223 ENSP00000430147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]