SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9UPZ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9UPZ9
Domain Number 1 Region: 1-285
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-95
Family Protein kinases, catalytic subunit 0.00000192
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9UPZ9
Sequence length 632
Comment (sp|Q9UPZ9|ICK_HUMAN) MAK-related kinase KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ICK; OC=Catarrhini; Hominidae; Homo.
Sequence
MNRYTTIRQLGDGTYGSVLLGRSIESGELIAIKKMKRKFYSWEECMNLREVKSLKKLNHA
NVVKLKEVIRENDHLYFIFEYMKENLYQLIKERNKLFPESAIRNIMYQILQGLAFIHKHG
FFHRDLKPENLLCMGPELVKIADFGLAREIRSKPPYTDYVSTRWYRAPEVLLRSTNYSSP
IDVWAVGCIMAEVYTLRPLFPGASEIDTIFKICQVLGTPKKTDWPEGYQLSSAMNFRWPQ
CVPNNLKTLIPNASSEAVQLLRDMLQWDPKKRPTASQALRYPYFQVGHPLGSTTQNLQDS
EKPQKGILEKAGPPPYIKPVPPAQPPAKPHTRISSRQHQASQPPLHLTYPYKAEVSRTDH
PSHLQEDKPSPLLFPSLHNKHPQSKITAGLEHKNGEIKPKSRRRWGLISRSTKDSDDWAD
LDDLDFSPSLSRIDLKNKKRQSDDTLCRFESVLDLKPSEPVGTGNSAPTQTSYQRRDTPT
LRSAAKQHYLKHSRYLPGISIRNGILSNPGKEFIPPNPWSSSGLSGKSSGTMSVISKVNS
VGSSSTSSSGLTGNYVPSFLKKEIGSAMQRVHLAPIPDPSPGYSSLKAMRPHPGRPFFHT
QPRSTPGLIPRPPAAQPVHGRTDWASKYASRR
Download sequence
Identical sequences A0A024RD59 Q9UPZ9
ENSP00000263043 ENSP00000349458 ENSP00000263043 9606.ENSP00000263043 ENSP00000263043 ENSP00000349458 NP_055735.1.87134 NP_055735.1.92137 NP_057597.2.87134 NP_057597.2.92137 XP_016865977.1.92137 XP_016865978.1.92137 XP_016865979.1.92137 XP_016865980.1.92137 XP_016865981.1.92137 gi|27477122|ref|NP_057597.2| gi|7662388|ref|NP_055735.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]