SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9UQ03 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9UQ03
Domain Number 1 Region: 50-312
Classification Level Classification E-value
Superfamily WD40 repeat-like 9.16e-41
Family WD40-repeat 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9UQ03
Sequence length 480
Comment (sp|Q9UQ03|COR2B_HUMAN) Protein FC96 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=CORO2B; OC=Catarrhini; Hominidae; Homo.
Sequence
MTVTKMSWRPQYRSSKFRNVYGKVANREHCFDGIPITKNVHDNHFCAVNTRFLAIVTESA
GGGSFLVIPLEQTGRIEPNYPKVCGHQGNVLDIKWNPFIDNIIASCSEDTSVRIWEIPEG
GLKRNMTEALLELHGHSRRVGLVEWHPTTNNILFSAGYDYKVLIWNLDVGEPVKMIDCHT
DVILCMSFNTDGSLLTTTCKDKKLRVIEPRSGRVLQEANCKNHRVNRVVFLGNMKRLLTT
GVSRWNTRQIALWDQEDLSMPLIEEEIDGLSGLLFPFYDADTHMLYLAGKGDGNIRYYEI
STEKPYLSYLMEFRSPAPQKGLGVMPKHGLDVSACEVFRFYKLVTLKGLIEPISMIVPRR
SDSYQEDIYPMTPGTEPALTPDEWLGGINRDPVLMSLKEGYKKSSKMVFKAPIKEKKSVV
VNGIDLLENVPPRTENELLRMFFRQQDEIRRLKEELAQKDIRIRQLQLELKNLRNSPKNC
Download sequence
Identical sequences A0A2J8UCB6 K7B5H8 Q9UQ03
9606.ENSP00000261861 ENSP00000454783 gi|148529011|ref|NP_006082.3| ENSP00000454783 NP_006082.3.87134 NP_006082.3.92137 XP_009427709.2.37143 ENSP00000261861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]