SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9UQ13 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9UQ13
Domain Number 1 Region: 100-395
Classification Level Classification E-value
Superfamily L domain-like 5.95e-61
Family Internalin LRR domain 0.024
Further Details:      
 
Domain Number 2 Region: 355-558
Classification Level Classification E-value
Superfamily L domain-like 2.72e-42
Family Internalin LRR domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9UQ13
Sequence length 582
Comment (sp|Q9UQ13|SHOC2_HUMAN) Protein sur-8 homolog KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=SHOC2; OC=Catarrhini; Hominidae; Homo.
Sequence
MSSSLGKEKDSKEKDPKVPSAKEREKEAKASGGFGKESKEKEPKTKGKDAKDGKKDSSAA
QPGVAFSVDNTIKRPNPAPGTRKKSSNAEVIKELNKCREENSMRLDLSKRSIHILPSSIK
ELTQLTELYLYSNKLQSLPAEVGCLVNLMTLALSENSLTSLPDSLDNLKKLRMLDLRHNK
LREIPSVVYRLDSLTTLYLRFNRITTVEKDIKNLSKLSMLSIRENKIKQLPAEIGELCNL
ITLDVAHNQLEHLPKEIGNCTQITNLDLQHNELLDLPDTIGNLSSLSRLGLRYNRLSAIP
RSLAKCSALEELNLENNNISTLPESLLSSLVKLNSLTLARNCFQLYPVGGPSQFSTIYSL
NMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTWTSMVELNLATNQLTKIPED
VSGLVSLEVLILSNNLLKKLPHGLGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTN
NQLTTLPRGIGHLTNLTHLGLGENLLTHLPEEIGTLENLEELYLNDNPNLHSLPFELALC
SKLSIMSIENCPLSHLPPQIVAGGPSFIIQFLKMQGPYRAMV
Download sequence
Identical sequences A0A287B795 A0A2J8W773 A0A2K5C7R5 A0A2K5Q0K5 F6Q6N0 F7IB91 G1PNN4 G3QZG6 H0X798 H2Q2K4 K9IMG6 L5K0V8 Q5RAV5 Q9UQ13 S7PPZ0
ENSMLUP00000012567 ENSCJAP00000035065 ENSP00000358464 ENSECAP00000010435 9598.ENSPTRP00000005186 9600.ENSPPYP00000003088 9606.ENSP00000358464 9796.ENSECAP00000010435 9823.ENSSSCP00000011322 ENSMLUP00000012567 ENSPTRP00000005186 ENSOGAP00000011275 ENSP00000265277 ENSOGAP00000011275 ENSECAP00000010435 ENSCJAP00000035036 ENSSSCP00000011322 ENSPPYP00000003088 HR3104 ENSGGOP00000008275 ENSPPYP00000003088 ENSSSCP00000011322 NP_001311265.1.87134 NP_001311265.1.92137 NP_001311266.1.87134 NP_001311266.1.92137 NP_031399.2.87134 NP_031399.2.92137 XP_001927528.1.46622 XP_002756642.1.60252 XP_003787217.1.62490 XP_003825630.1.60992 XP_005602291.1.31192 XP_005671514.1.46622 XP_005671515.1.46622 XP_005874601.1.60319 XP_005874602.1.60319 XP_006088185.1.53796 XP_006088186.1.53796 XP_006778770.1.95426 XP_006778771.1.95426 XP_006920921.1.64745 XP_006920922.1.64745 XP_008142528.1.99482 XP_008538861.1.77740 XP_008949158.1.60992 XP_009008521.1.60252 XP_011362043.1.92234 XP_011362044.1.92234 XP_011362045.1.92234 XP_011362046.1.92234 XP_012305621.1.9421 XP_012305623.1.9421 XP_012305624.1.9421 XP_012305625.1.9421 XP_014706653.1.49734 XP_015451820.1.64745 XP_016067618.1.3490 XP_016067619.1.3490 XP_016067620.1.3490 XP_016774806.1.37143 XP_016872191.1.92137 XP_016872192.1.92137 XP_016872193.1.92137 XP_017355165.1.71028 XP_017355166.1.71028 XP_017355167.1.71028 XP_017834798.1.60252 XP_018890309.1.27298 XP_021522552.1.9421 XP_021522553.1.9421 XP_021522554.1.9421 XP_521602.2.37143 ENSP00000358464 ENSPTRP00000005186 ENSGGOP00000008275 gi|41281398|ref|NP_031399.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]