SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9Y222 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9Y222
Domain Number 1 Region: 271-332
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000237
Family Myb/SANT domain 0.017
Further Details:      
 
Domain Number 2 Region: 210-272
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000171
Family DNA-binding domain of telomeric protein 0.054
Further Details:      
 
Domain Number 3 Region: 309-395
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000404
Family Myb/SANT domain 0.065
Further Details:      
 
Weak hits

Sequence:  Q9Y222
Domain Number - Region: 683-730
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 0.0942
Family Alkaline phosphatase 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9Y222
Sequence length 760
Comment (sp|Q9Y222|DMTF1_HUMAN) Cyclin-D-interacting Myb-like protein 1 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=DMTF1; OC=Catarrhini; Hominidae; Homo.
Sequence
MSTVEEDSDTVTVETVNSVTLTQDTEGNLILHCPQNEADEIDSEDSIEPPHKRLCLSSED
DQSIDDSTPCISVVALPLSENDQSFEVTMTATTEVADDEVTEGTVTQIQILQNEQLDEIS
PLGNEEVSAVSQAWFTTKEDKDSLTNKGHKWKQGMWSKEEIDILMNNIERYLKARGIKDA
TEIIFEMSKDERKDFYRTIAWGLNRPLFAVYRRVLRMYDDRNHVGKYTPEEIEKLKELRI
KHGNDWATIGAALGRSASSVKDRCRLMKDTCNTGKWTEEEEKRLAEVVHELTSTEPGDIV
TQGVSWAAVAERVGTRSEKQCRSKWLNYLNWKQSGGTEWTKEDEINLILRIAELDVADEN
DINWDLLAEGWSSVRSPQWLRSKWWTIKRQIANHKDVSFPVLIKGLKQLHENQKNNPTLL
ENKSGSGVPNSNTNSSVQHVQIRVARLEDNTAISSSPMAALQIPVQITHVSSADSPATVD
SETITLNSGTLQTFEILPSFHLQPTGTPGTYLLQTSSSQGLPLTLTASPTVTLTAAAPAS
PEQIIVHALSPEHLLNTSDNVTVQCHTPRVIIQTVATEDITSSISQAELTVDSDIQSSDF
PEPPDALEADTFPDEIHHPKMTVEPSFNDAHVSKFSDQNSTELMNSVMVRTEEEISDTDL
KQEESPSDLASAYVTEGLESPTIEEQVDQTIDDETILIVPSPHGFIQASDVIDTESVLPL
TTLTDPILQHHQEESNIIGSSLGSPVSEDSKDVEDLVNCH
Download sequence
Identical sequences Q9Y222
ENSP00000332171 ENSP00000378193 gi|215599967|ref|NP_066968.3| gi|215599992|ref|NP_001135799.1| ENSP00000332171 ENSP00000332171 ENSP00000378193 NP_001135799.1.87134 NP_001135799.1.92137 NP_066968.3.87134 NP_066968.3.92137 XP_011515037.1.92137 XP_011515039.1.92137 XP_016868354.1.92137 9606.ENSP00000332171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]