SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9Y279 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9Y279
Domain Number 1 Region: 23-136
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000494
Family V set domains (antibody variable domain-like) 0.021
Further Details:      
 
Domain Number 2 Region: 143-223
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000629
Family I set domains 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9Y279
Sequence length 399
Comment (sp|Q9Y279|VSIG4_HUMAN) Protein Z39Ig KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=VSIG4; OC=Catarrhini; Hominidae; Homo.
Sequence
MGILLGLLLLGHLTVDTYGRPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQR
GSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTP
DGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQ
QTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTK
TEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLPVFAIILIISLCCMVVFT
MAYIMLCRKTSQQEHVYEAARAHAREANDSGETMRVAIFASGCSSDEPTSQNLGNNYSDE
PCIGQEYQIIAQINGNYARLLDTVPLDYEFLATEGKSVC
Download sequence
Identical sequences Q9Y279
ENSP00000363869 ENSP00000363869 NP_009199.1.87134 NP_009199.1.92137 9606.ENSP00000363869 ENSP00000363869 NYSGRC-IgSF-VSIG4_HUMAN gi|6005958|ref|NP_009199.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]