SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9Y3T6 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9Y3T6
Domain Number 1 Region: 19-79
Classification Level Classification E-value
Superfamily R3H domain 0.000000000942
Family R3H domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9Y3T6
Sequence length 440
Comment (sp|Q9Y3T6|R3HC1_HUMAN) R3H and coiled-coil domain-containing protein 1 {ECO:0000312|HGNC:HGNC:27329} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=R3HCC1 OC=Catarrhini; Hominidae; Homo.
Sequence
MALLCLDGVFLSSAENDFVHRIQEELDRFLLQKQLSKVLLFPPLSSRLRYLIHRTAENFD
LLSSFSVGEGWKRRTVICHQDIRVPSSDGLSGPCRAPASCPSRYHGPRPISNQGAAAVPR
GARAGRWYRGRKPDQPLYVPRVLRRQEEWGLTSTSVLKREAPAGRDPEEPGDVGAGDPNS
DQGLPVLMTQGTEDLKGPGQRCENEPLLDPVGPEPLGPESQSGKGDMVEMATRFGSTLQL
DLEKGKESLLEKRLVAEEEEDEEEVEEDGPSSCSEDDYSELLQEITDNLTKKEIQIEKIH
LDTSSFVEELPGEKDLAHVVEIYDFEPALKTEDLLATFSEFQEKGFRIQWVDDTHALGIF
PCLASAAEALTREFSVLKIRPLTQGTKQSKLKALQRPKLLRLVKERPQTNATVARRLVAR
ALGLQHKKKERPAVRGPLPP
Download sequence
Identical sequences Q9Y3T6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]