SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9Y597 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9Y597
Domain Number 1 Region: 18-113
Classification Level Classification E-value
Superfamily POZ domain 3.93e-27
Family Tetramerization domain of potassium channels 0.0019
Further Details:      
 
Domain Number 2 Region: 212-449,517-573
Classification Level Classification E-value
Superfamily WD40 repeat-like 7.53e-19
Family WD40-repeat 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9Y597
Sequence length 815
Comment (sp|Q9Y597|KCTD3_HUMAN) Renal carcinoma antigen NY-REN-45 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=KCTD3; OC=Catarrhini; Hominidae; Homo.
Sequence
MAGGHCGSFPAAAAGSGEIVQLNVGGTRFSTSRQTLMWIPDSFFSSLLSGRISTLRDETG
AIFIDRDPAAFAPILNFLRTKELDLRGVSINVLRHEAEFYGITPLVRRLLLCEELERSSC
GSVLFHGYLPPPGIPSRKINNTVRSADSRNGLNSTEGEARGNGTQPVLSGTGEETVRLGF
PVDPRKVLIVAGHHNWIVAAYAHFAVCYRIKESSGWQQVFTSPYLDWTIERVALNAKVVG
GPHGDKDKMVAVASESSIILWSVQDGGSGSEIGVFSLGVPVDALFFIGNQLVATSHTGKV
GVWNAVTQHWQVQDVVPITSYDTAGSFLLLGCNNGSIYYIDMQKFPLRMKDNDLLVTELY
HDPSNDAITALSVYLTPKTSVSGNWIEIAYGTSSGAVRVIVQHPETVGSGPQLFQTFTVH
RSPVTKIMLSEKHLVSVCADNNHVRTWTVTRFRGMISTQPGSTPLASFKILSLEETESHG
SYSSGNDIGPFGERDDQQVFIQKVVPITNKLFVRLSSTGKRICEIQAVDCTTISSFTVRE
CEGSSRMGSRPRRYLFTGHTNGSIQMWDLTTAMDMVNKSEDKDVGGPTEEELLKLLDQCD
LSTSRCATPNISPATSVVQHSHLRESNSSLQLQHHDTTHEAATYGSMRPYRESPLLARAR
RTESFHSYRDFQTINLNRNVERAVPENGNLGPIQAEVKGATGECNISERKSPGVEIKSLR
ELDSGLEVHKIAEGFSESKKRSSEDENENKIEFRKKGGFEGGGFLGRKKVPYLASSPSTS
DGGTDSPGTASPSPTKTTPSPRHKKSDSSGQEYSL
Download sequence
Identical sequences K7B383 Q9Y597
NP_057205.2.87134 NP_057205.2.92137 XP_514196.3.37143 gi|46255026|ref|NP_057205.2| ENSP00000259154 ENSPTRP00000003324 ENSP00000259154 ENSP00000259154 9598.ENSPTRP00000003324 9606.ENSP00000259154 ENSPTRP00000003324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]