SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9Y5I1 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9Y5I1
Domain Number 1 Region: 230-353
Classification Level Classification E-value
Superfamily Cadherin-like 1.27e-32
Family Cadherin 0.00088
Further Details:      
 
Domain Number 2 Region: 442-565
Classification Level Classification E-value
Superfamily Cadherin-like 2.22e-29
Family Cadherin 0.0037
Further Details:      
 
Domain Number 3 Region: 343-446
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-23
Family Cadherin 0.0031
Further Details:      
 
Domain Number 4 Region: 126-235
Classification Level Classification E-value
Superfamily Cadherin-like 6.41e-20
Family Cadherin 0.0028
Further Details:      
 
Domain Number 5 Region: 558-669
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-16
Family Cadherin 0.0018
Further Details:      
 
Domain Number 6 Region: 29-125
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000007
Family Cadherin 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)


Protein sequence

External link(s) Q9Y5I1
Sequence length 949
Comment (sp|Q9Y5I1|PCDAB_HUMAN) Protocadherin alpha-11 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=PCDHA11; OC=Catarrhini; Hominidae; Homo.
Sequence
MFGFQRRGLGTPRLQLWLLLLEFWEVGSGQLHYSVSEEAKHGTFVGRIAQDLGLELAELV
QRLFRVASKTHGDLLEVNLQNGILFVNSRIDREELCGQSAECSIHLEVIVDRPLQVFHVN
VEVKDINDNPPVFSLREQKLLIAESKQSDSRFPLEGASDADIEENALLTYRLSKNEYFSL
DSPTNGKQIKRLSLILKKSLDREKTPELNLLLTATDGGKPELTGTVRLLVQVLDVNDNDP
EFDKSEYKVSLMENAAKETLVLKLNATDRDEGVNGEVTYSLMSIKPNGRHLFTLDQNNGE
VRVNGTLDYEENKFYKIEVQATDKGTPPMAGHCTVWVEILDTNDNSPEVAVTSLSLPVRE
DAQPSTVIALISVSDRDSGVNGQVTCSLTPHVPFKLVSTFKNYYSLVLDSALDRENVWAY
ELVVTARDGGSPSLWATARVSVEVADVNDNAPAFAQPEYTVFVKENNPPGCHIFTVSARD
ADAQENALVSYSLVERRLGDRALSSYVSVHAESGKVYALQPLDHEELELLQFQVSARDAG
VPPLSSNVTLQVFVLDENDNAPALLATQAGSAGGAVNKLVPRSVGAGHVVAKVRAVDADS
GYNAWLSYELQPAAGGSRIPFRVGLYTGEISTTRALDEADSPRHRLLVLVKDHGEPALTA
TATVLVSLVESGQAPKASSRTLAGAASPEAALVDVNVYLIIAICVVSSLLVLTLLLYTAL
WWSATPTEGACAPGKPTLVCSRAVGSWSYSQQRRQRVCSEEGPPKTDLMAFSPSLPLGLN
KEEEGERQEPGSNHPGQPRQPNPDWRYSASLRAGMHSSVHLEEAGILRAGPGGPDQQWPT
VSSATPEPEAGEVSPPVGAGVNSNSWTFKYGPGNPKQSGPGELPDKFIIPGSPAIISIRQ
EPTNSQIDKSDFITFGKKEETKKKKKKKKGNKTQEKKEKGNSTTDNSDQ
Download sequence
Identical sequences Q9Y5I1
ENSP00000381636 gi|9256576|ref|NP_061725.1| ENSP00000381636 ENSP00000381636 ENSP00000476622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]