SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9Y5K6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9Y5K6
Domain Number 1 Region: 271-351
Classification Level Classification E-value
Superfamily SH3-domain 5.64e-22
Family SH3-domain 0.00086
Further Details:      
 
Domain Number 2 Region: 109-168
Classification Level Classification E-value
Superfamily SH3-domain 3.54e-21
Family SH3-domain 0.0007
Further Details:      
 
Domain Number 3 Region: 4-59
Classification Level Classification E-value
Superfamily SH3-domain 9.58e-19
Family SH3-domain 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9Y5K6
Sequence length 639
Comment (sp|Q9Y5K6|CD2AP_HUMAN) Cas ligand with multiple SH3 domains KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=CD2AP; OC=Catarrhini; Hominidae; Homo.
Sequence
MVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRE
TEFKDDSLPIKRERHGNVASLVQRISTYGLPAGGIQPHPQTKNIKKKTKKRQCKVLFEYI
PQNEDELELKVGDIIDINEEVEEGWWSGTLNNKLGLFPSNFVKELEVTDDGETHEAQDDS
ETVLAGPTSPIPSLGNVSETASGSVTQPKKIRGIGFGDIFKEGSVKLRTRTSSSETEEKK
PEKPLILQSLGPKTQSVEITKTDTEGKIKAKEYCRTLFAYEGTNEDELTFKEGEIIHLIS
KETGEAGWWRGELNGKEGVFPDNFAVQINELDKDFPKPKKPPPPAKAPAPKPELIAAEKK
YFSLKPEEKDEKSTLEQKPSKPAAPQVPPKKPTPPTKASNLLRSSGTVYPKRPEKPVPPP
PPIAKINGEVSSISSKFETEPVSKLKLDSEQLPLRPKSVDFDSLTVRTSKETDVVNFDDI
ASSENLLHLTANRPKMPGRRLPGRFNGGHSPTHSPEKILKLPKEEDSANLKPSELKKDTC
YSPKPSVYLSTPSSASKANTTAFLTPLEIKAKVETDDVKKNSLDELRAQIIELLCIVEAL
KKDHGKELEKLRKDLEEEKTMRSNLEMEIEKLKKAVLSS
Download sequence
Identical sequences Q9Y5K6
NP_036252.1.87134 NP_036252.1.92137 ENSP00000352264 gi|11321634|ref|NP_036252.1| ENSP00000352264 ENSP00000352264 9606.ENSP00000352264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]