SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9Y5P2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9Y5P2
Sequence length 127
Comment (sp|Q9Y5P2|CSAG2_HUMAN) Taxol-resistant-associated gene 3 protein KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=CSAG3; OC=Catarrhini; Hominidae; Homo.
Sequence
MWMGLIQLVEGVKRKDQGFLEKEFYHKTNIKMRCEFLACWPAFTVLGEAWRDQVDWSRLL
RDAGLVKMSRKPRASSPLSNNHPPTPKRRGSGRHPLNPGPEALSKFPRQPGREKGPIKEV
PGTKGSP
Download sequence
Identical sequences Q9Y5P2
NP_001123298.1.87134 NP_001123298.1.92137 gi|157502216|ref|NP_001074317.2| gi|193788718|ref|NP_001123298.1| 9606.ENSP00000349380 9606.ENSP00000402672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]