SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9Y5Y2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9Y5Y2
Domain Number 1 Region: 10-243
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.42e-56
Family Nitrogenase iron protein-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9Y5Y2
Sequence length 271
Comment (sp|Q9Y5Y2|NUBP2_HUMAN) Nucleotide-binding protein 2 {ECO:0000255|HAMAP-Rule:MF_03039} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=NUBP2 OC=Catarrhini; Hominidae; Homo.
Sequence
MEAAAEPGNLAGVRHIILVLSGKGGVGKSTISTELALALRHAGKKVGILDVDLCGPSIPR
MLGAQGRAVHQCDRGWAPVFLDREQSISLMSVGFLLEKPDEAVVWRGPKKNALIKQFVSD
VAWGELDYLVVDTPPGTSDEHMATIEALRPYQPLGALVVTTPQAVSVGDVRRELTFCRKT
GLRVMGIVENMSGFTCPHCTECTSVFSRGGGEELAQLAGVPFLGSVPLDPALMRTLEEGH
DFIQEFPGSPAFAALTSIAQKILDATPACLP
Download sequence
Identical sequences Q9Y5Y2
Hs6912540___KOG3022 NP_036357.1.87134 NP_036357.1.92137 HR5101 hss001000162.1 ENSP00000262302 ENSP00000262302 9606.ENSP00000262302 ENSP00000262302 gi|6912540|ref|NP_036357.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]