SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9Y616 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9Y616
Domain Number 1 Region: 151-452
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.63e-57
Family Protein kinases, catalytic subunit 0.00068
Further Details:      
 
Domain Number 2 Region: 4-106
Classification Level Classification E-value
Superfamily DEATH domain 1.75e-29
Family DEATH domain, DD 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9Y616
Sequence length 596
Comment (sp|Q9Y616|IRAK3_HUMAN) IL-1 receptor-associated kinase M KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=IRAK3 OC=Catarrhini; Hominidae; Homo.
Sequence
MAGNCGARGALSAHTLLFDLPPALLGELCAVLDSCDGALGWRGLAERLSSSWLDVRHIEK
YVDQGKSGTRELLWSWAQKNKTIGDLLQVLQEMGHRRAIHLITNYGAVLSPSEKSYQEGG
FPNILFKETANVTVDNVLIPEHNEKGILLKSSISFQNIIEGTRNFHKDFLIGEGEIFEVY
RVEIQNLTYAVKLFKQEKKMQCKKHWKRFLSELEVLLLFHHPNILELAAYFTETEKFCLI
YPYMRNGTLFDRLQCVGDTAPLPWHIRIGILIGISKAIHYLHNVQPCSVICGSISSANIL
LDDQFQPKLTDFAMAHFRSHLEHQSCTINMTSSSSKHLWYMPEEYIRQGKLSIKTDVYSF
GIVIMEVLTGCRVVLDDPKHIQLRDLLRELMEKRGLDSCLSFLDKKVPPCPRNFSAKLFC
LAGRCAATRAKLRPSMDEVLNTLESTQASLYFAEDPPTSLKSFRCPSPLFLENVPSIPVE
DDESQNNNLLPSDEGLRIDRMTQKTPFECSQSEVMFLSLDKKPESKRNEEACNMPSSSCE
ESWFPKYIVPSQDLRPYKVNIDPSSEAPGHSCRSRPVESSCSSKFSWDEYEQYKKE
Download sequence
Identical sequences Q9Y616
ENSP00000261233 NP_009130.2.87134 NP_009130.2.92137 ENSP00000261233 gi|216547519|ref|NP_009130.2| ENSP00000261233 9606.ENSP00000261233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]