SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9Y675 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9Y675
Sequence length 71
Comment (sp|Q9Y675|SNURF_HUMAN) SNRPN upstream reading frame protein KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=SNURF; OC=Catarrhini; Hominidae; Homo.
Sequence
MERARDRLHLRRTTEQHVPEVEVQVKRRRTASLSNQECQLYPRRSQQQQVPVVDFQAELR
QAFLAETPRGG
Download sequence
Identical sequences A0A024R0T6 A0A2I2YRU9 A0A2I3MEW9 A0A2J8KLF4 A0A2J8SEP2 A0A2K5F3U5 A5A6K1 G1QKZ9 Q9XS97 Q9Y675
gi|13027653|ref|NP_005669.2| gi|13027655|ref|NP_073715.1| ENSOCUP00000026167 ENSP00000342152 ENSP00000451421 ENSP00000463201 ENSP00000463396 ENSNLEP00000001607 ENSPTRP00000058086 ENSNLEP00000001607 9606.ENSP00000342152 9986.ENSOCUP00000023112 ENSPTRP00000058086 ENSOCUP00000026167 ENSP00000336543 ENSP00000342152 ENSP00000451421 ENSP00000463201 ENSP00000463396 NP_001076183.1.1745 NP_001104285.1.37143 NP_005669.2.87134 NP_005669.2.92137 NP_073715.1.87134 NP_073715.1.92137 XP_003277194.1.23891 XP_003277195.1.23891 XP_003277196.1.23891 XP_003277198.1.23891 XP_004055895.1.27298 XP_004088330.1.23891 XP_004617616.1.94378 XP_005381736.1.28644 XP_005618294.1.84170 XP_005618296.1.84170 XP_008015566.1.81039 XP_008704535.1.72690 XP_008959659.1.60992 XP_010331147.1.74449 XP_010354439.1.97406 XP_010354447.1.97406 XP_011798251.1.43180 XP_011798252.1.43180 XP_011798253.1.43180 XP_011798254.1.43180 XP_011798255.1.43180 XP_011857812.1.47321 XP_011857814.1.47321 XP_011857815.1.47321 XP_011931161.1.92194 XP_011931162.1.92194 XP_012362783.1.23891 XP_014997176.1.72884 XP_014997177.1.72884 XP_015362078.1.40921 XP_017200253.1.1745 XP_017737847.1.44346 XP_017737848.1.44346 XP_018866104.1.27298 XP_019523299.1.44202 XP_021530244.1.9421 ENSP00000336543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]