SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9Y692 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9Y692
Domain Number 1 Region: 92-179
Classification Level Classification E-value
Superfamily SAND domain-like 1.92e-30
Family SAND domain 0.00000354
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9Y692
Sequence length 573
Comment (sp|Q9Y692|GMEB1_HUMAN) Parvovirus initiation factor p96 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=GMEB1; OC=Catarrhini; Hominidae; Homo.
Sequence
MANAEVSVPVGDVVVVPTEGNEGENPEDTKTQVILQLQPVQQGLFIDGHFYNRIYEAGSE
NNTAVVAVETHTIHKIEEGIDTGTIEANEDMEIAYPITCGESKAILLWKKFVCPGINVKC
VKFNDQLISPKHFVHLAGKSTLKDWKRAIRLGGIMLRKMMDSGQIDFYQHDKVCSNTCRS
TKFDLLISSARAPVPGQQTSVVQTPTSADGSITQIAISEESMEEAGLEWNSALTAAVTMA
TEEGVKKDSEEISEDTLMFWKGIADVGLMEEVVCNIQKEIEELLRGVQQRLIQAPFQVTD
AAVLNNVAHTFGLMDTVKKVLDNRRNQVEQGEEQFLYTLTDLERQLEEQKKQGQDHRLKS
QTVQNVVLMPVSTPKPPKRPRLQRPASTTVLSPSPPVQQPQFTVISPITITPVGQSFSMG
NIPVATLSQGSSPVTVHTLPSGPQLFRYATVVSSAKSSSPDTVTIHPSSSLALLSSTAMQ
DGSTLGNMTTMVSPVELVAMESGLTSAIQAVESTSEDGQTIIEIDPAPDPEAEDTEGKAV
ILETELRTEEKVVAEMEEHQHQVHNVEIVVLED
Download sequence
Identical sequences G3R1F0 K7D7A1 Q9Y692
ENSGGOP00000009009 gi|13435377|ref|NP_006573.2| ENSP00000294409 9606.ENSP00000294409 ENSP00000294409 ENSP00000362922 NP_006573.2.87134 NP_006573.2.92137 XP_003828148.1.60992 XP_004025364.1.27298 XP_008951665.1.60992 XP_011538820.1.92137 XP_011538821.1.92137 XP_014199803.1.60992 XP_016855576.1.92137 ENSGGOP00000009009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]