SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9Y6K9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9Y6K9
Sequence length 419
Comment (sp|Q9Y6K9|NEMO_HUMAN) NF-kappa-B essential modifier KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=IKBKG; OC=Catarrhini; Hominidae; Homo.
Sequence
MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQE
LRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQ
ALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQ
ARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQE
YDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV
LKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRH
VEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
Download sequence
Identical sequences Q9Y6K9
gi|153792133|ref|NP_001093327.1| gi|4504631|ref|NP_003630.1| NP_001093327.1.87134 NP_001093327.1.92137 NP_001308325.1.87134 NP_001308325.1.92137 NP_003630.1.87134 NP_003630.1.92137 ENSP00000471166 ENSP00000479662 ENSP00000358614 ENSP00000358619 ENSP00000358620 ENSP00000471166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]