SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9Y6L7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9Y6L7
Domain Number 1 Region: 154-348
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.18e-59
Family Astacin 0.0000888
Further Details:      
 
Domain Number 2 Region: 620-730
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-37
Family Spermadhesin, CUB domain 0.00021
Further Details:      
 
Domain Number 3 Region: 781-887
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.06e-36
Family Spermadhesin, CUB domain 0.00021
Further Details:      
 
Domain Number 4 Region: 470-573
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.02e-35
Family Spermadhesin, CUB domain 0.00029
Further Details:      
 
Domain Number 5 Region: 355-464
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-35
Family Spermadhesin, CUB domain 0.0005
Further Details:      
 
Domain Number 6 Region: 911-1004
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.94e-29
Family Spermadhesin, CUB domain 0.00047
Further Details:      
 
Domain Number 7 Region: 731-773
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000031
Family EGF-type module 0.01
Further Details:      
 
Domain Number 8 Region: 575-617
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000419
Family EGF-type module 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9Y6L7
Sequence length 1015
Comment (sp|Q9Y6L7|TLL2_HUMAN) Tolloid-like protein 2 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=TLL2; OC=Catarrhini; Hominidae; Homo.
Sequence
MPRATALGALVSLLLLLPLPRGAGGLGERPDATADYSELDGEEGTEQQLEHYHDPCKAAV
FWGDIALDEDDLKLFHIDKARDWTKQTVGATGHSTGGLEEQASESSPDTTAMDTGTKEAG
KDGRENTTLLHSPGTLHAAAKTFSPRVRRATTSRTERIWPGGVIPYVIGGNFTGSQRAIF
KQAMRHWEKHTCVTFIERTDEESFIVFSYRTCGCCSYVGRRGGGPQAISIGKNCDKFGIV
AHELGHVVGFWHEHTRPDRDQHVTIIRENIQPGQEYNFLKMEAGEVSSLGETYDFDSIMH
YARNTFSRGVFLDTILPRQDDNGVRPTIGQRVRLSQGDIAQARKLYKCPACGETLQDTTG
NFSAPGFPNGYPSYSHCVWRISVTPGEKIVLNFTSMDLFKSRLCWYDYVEVRDGYWRKAP
LLGRFCGDKIPEPLVSTDSRLWVEFRSSSNILGKGFFAAYEATCGGDMNKDAGQIQSPNY
PDDYRPSKECVWRITVSEGFHVGLTFQAFEIERHDSCAYDYLEVRDGPTEESALIGHFCG
YEKPEDVKSSSNRLWMKFVSDGSINKAGFAANFFKEVDECSWPDHGGCEHRCVNTLGSYK
CACDPGYELAADKKMCEVACGGFITKLNGTITSPGWPKEYPTNKNCVWQVVAPAQYRISL
QFEVFELEGNDVCKYDFVEVRSGLSPDAKLHGRFCGSETPEVITSQSNNMRVEFKSDNTV
SKRGFRAHFFSDKDECAKDNGGCQHECVNTFGSYLCRCRNGYWLHENGHDCKEAGCAHKI
SSVEGTLASPNWPDKYPSRRECTWNISSTAGHRVKLTFNEFEIEQHQECAYDHLEMYDGP
DSLAPILGRFCGSKKPDPTVASGSSMFLRFYSDASVQRKGFQAVHSTECGGRLKAEVQTK
ELYSHAQFGDNNYPSEARCDWVIVAEDGYGVELTFRTFEVEEEADCGYDYMEAYDGYDSS
APRLGRFCGSGPLEEIYSAGDSLMIRFRTDDTINKKGFHARYTSTKFQDALHMKK
Download sequence
Identical sequences Q9Y6L7
NP_036597.1.87134 NP_036597.1.92137 ENSP00000350630 gi|6912724|ref|NP_036597.1| 9606.ENSP00000350630 ENSP00000350630 ENSP00000350630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]