SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for VDAG_02810T0 from Verticillium dahliae VdLs.17

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  VDAG_02810T0
Domain Number 1 Region: 279-534
Classification Level Classification E-value
Superfamily Tetrapyrrole methylase 4.19e-52
Family Tetrapyrrole methylase 0.0000305
Further Details:      
 
Domain Number 2 Region: 121-188,219-263
Classification Level Classification E-value
Superfamily Siroheme synthase middle domains-like 9.42e-24
Family Siroheme synthase middle domains-like 0.0048
Further Details:      
 
Domain Number 3 Region: 5-122
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.000000669
Family Siroheme synthase N-terminal domain-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) VDAG_02810T0
Sequence length 560
Comment | VDAG_02810 | Verticillium dahliae VdLs.17 uroporphyrinogen-III C-methyltransferase (561 aa)
Sequence
MSLLAALNCTGNVHLIIGTNPLAASRCGQSVAAGAKALLIAPDTEDLHYGLAKRIDAGEV
TWHKKAFEDSDLFSLGRDEVDHVVDAVFITSGPRDPQASHISALCKRNRIPVNVVDAPHL
CTLSLLSVHTDGPLQIGVTTNGRGCKLASRIRREVAAALPPDLGSACARLGDARRRIQQE
DQHAHSQTDVDADADDSVDQTASFNKLVIEADLEAAKTRRMRWLSQVCEYWPLKRLAAIT
DADVATVLESYANLSALLPDAPLPPLTAPPAAAAAGRPAVGKIILAGSGPGHPDLLTRAT
HKAILTADLILADKLVPAPVLDLIPRRTPVRIARKFPGNADAAQDELHALALAAARDEGK
TVLRLKQGDPFLYGRGGEEVAFFRAHGLGARVVVLPGVTSALSAPLFAGIPVTQRDVADQ
VLVCTGTGKKGKAPVPPEYLEARTVVFLMALHRISGLVNELTAPLEGEGEGEGEGEGMRK
LWPRSTPCAVIERASCPDQRVIRTTLGVVAEAIEAEGSRPPGLLVVGRACEALYTPEKGR
AWVVEDGFRGMDSDDVVALP
Download sequence
Identical sequences A0A2J8C005 G2WX31
XP_009651758.1.79873 VDAG_02810T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]