SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000007255 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000007255
Domain Number 1 Region: 290-483
Classification Level Classification E-value
Superfamily Hemopexin-like domain 7.06e-60
Family Hemopexin-like domain 0.00000652
Further Details:      
 
Domain Number 2 Region: 109-273
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.9e-57
Family Matrix metalloproteases, catalytic domain 0.00000501
Further Details:      
 
Domain Number 3 Region: 29-105
Classification Level Classification E-value
Superfamily PGBD-like 1.18e-17
Family MMP N-terminal domain 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Golgi lumen 2.192 19.32
brush border 1.358 15.67
cell surface 1.26 11.29
neuron projection terminus 2.098 10.13
exocytic vesicle 2.005 10.08
organelle subcompartment 1.51 9.21
Golgi membrane 1.579 9.21
trans-Golgi network 2.053 9.21
lytic vacuole 1.528 8.74
vacuolar part 1.508 7.04

Protein sequence

External link(s) Protein: ENSPTRP00000007255   Gene: ENSPTRG00000004216   Transcript: ENSPTRT00000007863
Sequence length 483
Comment pep:known_by_projection chromosome:CHIMP2.1.4:11:100421761:100470107:-1 gene:ENSPTRG00000004216 transcript:ENSPTRT00000007863 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVLPASGLAVFLIMALKFSTAAPSLVAASPRTWRNNYRLAQAYLDKYYTNKEGHQIGEM
VARGSNSMIRKIKELQAFFGLQVTGKLDQTTMNVIKKPRCGVPDVANYRLFPGEPKWKKN
ILTYRISKYTPSMSSVEVDKAVEMALQAWSSAVPLSFVRINSGEADIMISFENGDHGDSY
PFDGPRGTLAHAFAPGEGLGGDTHFDNAEKWTMGTNGFNLFTVAAHEFGHALGLAHSTDP
SALMYPTYKYKNPYGFHLPKDDVKGIQALYGPRKAFLGKPTLPHAPHHKPSIPDLCDSSS
SFDAVTMLGKELLLFKDRIFWRRQVHLRTGIRPSTITSSFPQLMSNVDAAYEVAERGTAY
FFKGPHYWITRGFQMQGPPRTIYDFGFPRHVQQIDAAVYLREPQKTLFFVGDEYYSYDER
KKKMGKDYPKNTEEEFSGVNGQIDAAVELNGYIYFFSGPKTYKYDTEKEDVVSVVKSSSW
IGC
Download sequence
Identical sequences H2Q4M8
9598.ENSPTRP00000007255 ENSPTRP00000007255 ENSPTRP00000007255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]