SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSPTRP00000007255 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000007255
Domain Number 1 Region: 290-483
Classification Level Classification E-value
Superfamily Hemopexin-like domain 7.06e-60
Family Hemopexin-like domain 6.52e-06
Further Details:      
 
Domain Number 2 Region: 109-273
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.9e-57
Family Matrix metalloproteases, catalytic domain 5.01e-06
Further Details:      
 
Domain Number 3 Region: 29-105
Classification Level Classification E-value
Superfamily PGBD-like 1.18e-17
Family MMP N-terminal domain 0.00073
Further Details:      
 

Protein sequence

External link(s) Protein: ENSPTRP00000007255   Gene: ENSPTRG00000004216   Transcript: ENSPTRT00000007863
Sequence length 483
Comment pep:known_by_projection chromosome:CHIMP2.1.4:11:100421761:100470107:-1 gene:ENSPTRG00000004216 transcript:ENSPTRT00000007863 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVLPASGLAVFLIMALKFSTAAPSLVAASPRTWRNNYRLAQAYLDKYYTNKEGHQIGEM
VARGSNSMIRKIKELQAFFGLQVTGKLDQTTMNVIKKPRCGVPDVANYRLFPGEPKWKKN
ILTYRISKYTPSMSSVEVDKAVEMALQAWSSAVPLSFVRINSGEADIMISFENGDHGDSY
PFDGPRGTLAHAFAPGEGLGGDTHFDNAEKWTMGTNGFNLFTVAAHEFGHALGLAHSTDP
SALMYPTYKYKNPYGFHLPKDDVKGIQALYGPRKAFLGKPTLPHAPHHKPSIPDLCDSSS
SFDAVTMLGKELLLFKDRIFWRRQVHLRTGIRPSTITSSFPQLMSNVDAAYEVAERGTAY
FFKGPHYWITRGFQMQGPPRTIYDFGFPRHVQQIDAAVYLREPQKTLFFVGDEYYSYDER
KKKMGKDYPKNTEEEFSGVNGQIDAAVELNGYIYFFSGPKTYKYDTEKEDVVSVVKSSSW
IGC
Download sequence
Identical sequences H2Q4M8
9598.ENSPTRP00000007255 ENSPTRP00000007255 ENSPTRP00000007255

Jump to [ Top of page · Domain architecture · Domain assignment details ]