SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSPTRP00000007258 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000007258
Domain Number 1 Region: 273-464
Classification Level Classification E-value
Superfamily Hemopexin-like domain 8.24e-67
Family Hemopexin-like domain 3.99e-07
Further Details:      
 
Domain Number 2 Region: 101-262
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.9e-56
Family Matrix metalloproteases, catalytic domain 6.15e-08
Further Details:      
 
Domain Number 3 Region: 32-95
Classification Level Classification E-value
Superfamily PGBD-like 3.14e-20
Family MMP N-terminal domain 0.00032
Further Details:      
 

Protein sequence

External link(s) Protein: ENSPTRP00000007258   Gene: ENSPTRG00000004218   Transcript: ENSPTRT00000007866
Sequence length 467
Comment pep:known_by_projection chromosome:CHIMP2.1.4:11:100557249:100570701:-1 gene:ENSPTRG00000004218 transcript:ENSPTRT00000007866 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSLKMLPFLLLLHVQISKAFPVSSKEKNTKIVQDYLEKFYQLPSNQYQSTRKNGTNVIV
EKLKEMQRFFGLNVTGKPNEETLDMMKKPRCGVPDSGGFMLTPGNPKWEHTNLTYRIRNY
TPQLSEAEVERAIKDAFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNGIL
AHAFQPGQGIGGDAHFDAEETWTDTSANYNLFLVAAHEFGHSLGLAHSSDPGALMYPNYA
FRETSNYSLPQDDIDGIQAIYGLSSNPIQPTGPSTPKPCDPSLTFDAITTLRGEILFFKD
RYFWRRHPQLQRVEMNFISLFWPSLPTGIQAAYEDFDRDLIFLFKGNQYWALSGYDILQG
YPKDIANYGFPSSVQAIDAAVFYRSKTYFFVNDQFWRYDNQRQFMEPGYPKSISGAFPGI
ESKVDAVFQQEHFFLFFSGPRYYAFDLIAQRVTRVARGNKWLNCRYG
Download sequence
Identical sequences H2Q4N0
9598.ENSPTRP00000007258 ENSPTRP00000007258 ENSPTRP00000007258

Jump to [ Top of page · Domain architecture · Domain assignment details ]