SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000007258 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000007258
Domain Number 1 Region: 273-464
Classification Level Classification E-value
Superfamily Hemopexin-like domain 8.24e-67
Family Hemopexin-like domain 0.000000399
Further Details:      
 
Domain Number 2 Region: 101-262
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.9e-56
Family Matrix metalloproteases, catalytic domain 0.0000000615
Further Details:      
 
Domain Number 3 Region: 32-95
Classification Level Classification E-value
Superfamily PGBD-like 3.14e-20
Family MMP N-terminal domain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Golgi lumen 2.203 18.76
brush border 1.374 15.67
cell surface 1.254 10.8
neuron projection terminus 2.118 10
exocytic vesicle 1.972 9.76
Golgi membrane 1.598 9.31
organelle subcompartment 1.509 9.31
Golgi subcompartment 1.933 9.31
vacuolar part 1.514 6.31
presynapse 1.738 5.45
Molecular Function IC (bits) H-Score
metallopeptidase activity 2.041 167.72
endopeptidase activity 1.575 149.53
zinc ion binding 1.578 42.76
growth factor receptor binding 2.174 15.97
cytokine receptor binding 1.96 15.97
enzyme activator activity 1.428 14.65
integrin binding 1.558 12.29
fibronectin binding 2.151 10.88
serine hydrolase activity 1.585 10.17
peptide transporter activity 1.652 10

Protein sequence

External link(s) Protein: ENSPTRP00000007258   Gene: ENSPTRG00000004218   Transcript: ENSPTRT00000007866
Sequence length 467
Comment pep:known_by_projection chromosome:CHIMP2.1.4:11:100557249:100570701:-1 gene:ENSPTRG00000004218 transcript:ENSPTRT00000007866 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSLKMLPFLLLLHVQISKAFPVSSKEKNTKIVQDYLEKFYQLPSNQYQSTRKNGTNVIV
EKLKEMQRFFGLNVTGKPNEETLDMMKKPRCGVPDSGGFMLTPGNPKWEHTNLTYRIRNY
TPQLSEAEVERAIKDAFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNGIL
AHAFQPGQGIGGDAHFDAEETWTDTSANYNLFLVAAHEFGHSLGLAHSSDPGALMYPNYA
FRETSNYSLPQDDIDGIQAIYGLSSNPIQPTGPSTPKPCDPSLTFDAITTLRGEILFFKD
RYFWRRHPQLQRVEMNFISLFWPSLPTGIQAAYEDFDRDLIFLFKGNQYWALSGYDILQG
YPKDIANYGFPSSVQAIDAAVFYRSKTYFFVNDQFWRYDNQRQFMEPGYPKSISGAFPGI
ESKVDAVFQQEHFFLFFSGPRYYAFDLIAQRVTRVARGNKWLNCRYG
Download sequence
Identical sequences H2Q4N0
ENSPTRP00000007258 9598.ENSPTRP00000007258 ENSPTRP00000007258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]