SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000007258 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000007258
Domain Number 1 Region: 273-464
Classification Level Classification E-value
Superfamily Hemopexin-like domain 8.24e-67
Family Hemopexin-like domain 0.000000399
Further Details:      
 
Domain Number 2 Region: 101-262
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.9e-56
Family Matrix metalloproteases, catalytic domain 0.0000000615
Further Details:      
 
Domain Number 3 Region: 32-95
Classification Level Classification E-value
Superfamily PGBD-like 3.14e-20
Family MMP N-terminal domain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
metallopeptidase activity 2.054 168.98
endopeptidase activity 1.571 151.3
zinc ion binding 1.527 42.04
cytokine receptor binding 1.974 16.02
growth factor receptor binding 2.188 16.02
enzyme activator activity 1.431 14.69
integrin binding 1.56 12.29
fibronectin binding 2.165 10.75
serine hydrolase activity 1.589 10.26
peptide transporter activity 1.665 9.96
Cellular Component IC (bits) H-Score
Golgi lumen 2.224 18.39
cell surface 1.3 10.4
Golgi membrane 1.639 9.22
trans-Golgi network 1.766 9.22
neuron projection terminus 2.125 9.05
exocytic vesicle 2.03 8.34
vacuolar part 1.567 6.28
dendrite 1.582 5.69
host cell part 1.996 5.41
lysosomal membrane 1.946 5.05

Protein sequence

External link(s) Protein: ENSPTRP00000007258   Gene: ENSPTRG00000004218   Transcript: ENSPTRT00000007866
Sequence length 467
Comment pep:known_by_projection chromosome:CHIMP2.1.4:11:100557249:100570701:-1 gene:ENSPTRG00000004218 transcript:ENSPTRT00000007866 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSLKMLPFLLLLHVQISKAFPVSSKEKNTKIVQDYLEKFYQLPSNQYQSTRKNGTNVIV
EKLKEMQRFFGLNVTGKPNEETLDMMKKPRCGVPDSGGFMLTPGNPKWEHTNLTYRIRNY
TPQLSEAEVERAIKDAFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNGIL
AHAFQPGQGIGGDAHFDAEETWTDTSANYNLFLVAAHEFGHSLGLAHSSDPGALMYPNYA
FRETSNYSLPQDDIDGIQAIYGLSSNPIQPTGPSTPKPCDPSLTFDAITTLRGEILFFKD
RYFWRRHPQLQRVEMNFISLFWPSLPTGIQAAYEDFDRDLIFLFKGNQYWALSGYDILQG
YPKDIANYGFPSSVQAIDAAVFYRSKTYFFVNDQFWRYDNQRQFMEPGYPKSISGAFPGI
ESKVDAVFQQEHFFLFFSGPRYYAFDLIAQRVTRVARGNKWLNCRYG
Download sequence
Identical sequences H2Q4N0
ENSPTRP00000007258 ENSPTRP00000007258 9598.ENSPTRP00000007258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]