SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSPTRP00000060270 from Pan troglodytes 73_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000060270
Domain Number 1 Region: 321-517
Classification Level Classification E-value
Superfamily Hemopexin-like domain 5.36e-69
Family Hemopexin-like domain 7.46e-06
Further Details:      
 
Domain Number 2 Region: 109-275
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 9.07e-57
Family Matrix metalloproteases, catalytic domain 1.14e-07
Further Details:      
 
Domain Number 3 Region: 18-92
Classification Level Classification E-value
Superfamily PGBD-like 1.07e-19
Family MMP N-terminal domain 0.0036
Further Details:      
 

Protein sequence

External link(s) Protein: ENSPTRP00000060270   Gene: ENSPTRG00000013434   Transcript: ENSPTRT00000074314
Sequence length 593
Comment pep:known_by_projection chromosome:CHIMP2.1.4:20:32052239:32103884:1 gene:ENSPTRG00000013434 transcript:ENSPTRT00000074314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRSRGGRAAPGPPLAVARADEAEAPFAGQNWLKSYGYLLPYDSRASALHSAKALQSAVS
TMQQFYGIPVTGVLDQTTIEWMKKPRCGVPDHPHLSRRRRNKRYALTGQKWRQKHITYSI
HNYTPKVGELDTRKAIRQAFDVWQKVTPLTFEEVPYHEIKSDRKEADIMIFFASGFHGDS
SPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNANHDGNDLFLVAVHELGHALGLEH
SSDPSAIMAPFYQYMETHNFKLPQDDLQGIQKIYGPPAEPLEPTRPLPTLPVRRIHSPSE
RKHERQPRPPRPPLGDRPSTPGTKPNICDGNFNTVALFRGEMFVFKDRWFWRLRNNRVQE
GYPMQIEQFWKGLPARIDAAYERADGRFVFFKGDKYWVFKEVTVEPGYPHSLGELGSCLP
REGIDTALRWEPVGKTYFFKGERYWRYSEERRATDPGYPKPITVWKGIPQAPQGAFISKE
GYYTYFYKGRDYWKFDNQKLSVEPGYPRNILRDWMGCNQKEVERRKERRLPQDDVDIMVT
INDVPGSVNAVAVVIPCILSLCILVLVYTIFQFKNKTGPQPVTYYKRPVQEWV
Download sequence
Identical sequences H2RFH7
ENSPTRP00000060270

Jump to [ Top of page · Domain architecture · Domain assignment details ]