SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000060270 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000060270
Domain Number 1 Region: 321-517
Classification Level Classification E-value
Superfamily Hemopexin-like domain 5.36e-69
Family Hemopexin-like domain 0.00000746
Further Details:      
 
Domain Number 2 Region: 109-275
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 9.07e-57
Family Matrix metalloproteases, catalytic domain 0.000000114
Further Details:      
 
Domain Number 3 Region: 18-92
Classification Level Classification E-value
Superfamily PGBD-like 1.07e-19
Family MMP N-terminal domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000060270   Gene: ENSPTRG00000013434   Transcript: ENSPTRT00000074314
Sequence length 593
Comment pep:known_by_projection chromosome:CHIMP2.1.4:20:32052239:32103884:1 gene:ENSPTRG00000013434 transcript:ENSPTRT00000074314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRSRGGRAAPGPPLAVARADEAEAPFAGQNWLKSYGYLLPYDSRASALHSAKALQSAVS
TMQQFYGIPVTGVLDQTTIEWMKKPRCGVPDHPHLSRRRRNKRYALTGQKWRQKHITYSI
HNYTPKVGELDTRKAIRQAFDVWQKVTPLTFEEVPYHEIKSDRKEADIMIFFASGFHGDS
SPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNANHDGNDLFLVAVHELGHALGLEH
SSDPSAIMAPFYQYMETHNFKLPQDDLQGIQKIYGPPAEPLEPTRPLPTLPVRRIHSPSE
RKHERQPRPPRPPLGDRPSTPGTKPNICDGNFNTVALFRGEMFVFKDRWFWRLRNNRVQE
GYPMQIEQFWKGLPARIDAAYERADGRFVFFKGDKYWVFKEVTVEPGYPHSLGELGSCLP
REGIDTALRWEPVGKTYFFKGERYWRYSEERRATDPGYPKPITVWKGIPQAPQGAFISKE
GYYTYFYKGRDYWKFDNQKLSVEPGYPRNILRDWMGCNQKEVERRKERRLPQDDVDIMVT
INDVPGSVNAVAVVIPCILSLCILVLVYTIFQFKNKTGPQPVTYYKRPVQEWV
Download sequence
Identical sequences ENSPTRP00000060270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]