SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000006492 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000006492
Domain Number 1 Region: 369-447
Classification Level Classification E-value
Superfamily C-type lectin-like 8.92e-19
Family C-type lectin domain 0.00011
Further Details:      
 
Domain Number 2 Region: 441-500
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000208
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 3 Region: 277-313
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000602
Family EGF-type module 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000006492   Gene: ENSSARG00000007138   Transcript: ENSSART00000007163
Sequence length 540
Comment pep:novel genescaffold:COMMON_SHREW1:GeneScaffold_2970:218:8942:1 gene:ENSSARG00000007138 transcript:ENSSART00000007163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAQPSALPEPADPDALETIITVTETLKELQLPPEAMESESRGAIYSIPIPEDGAGGSSTL
EDPAEAPRTVLEFESQSLAPPTGSSEEEGRALEDEEEYKEEEEDVEDEALWAWPGDPSSP
DSRVLVPTKAPEEWRSQASLPTRARATFQPGVSPPSRQEGVPRVLGPPLVGLPTPRRGNL
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDCVPSPCHNGGTCLEEDEGVRCL
CLPGYGGHLCDVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXRYREYQIGLNDRIIEGDFLRSDGVPVLYENWNPGQPDSYFLSGENCVVMVWHDE
GQWSDVPCNYHLSYTCKMGLVSCGPPPELPLALVFGRPQLRYEVDTVLRYQCREGLAQRN
LPLIRCQEDGHWETPQISCVPRRPARSLPPFKTPEVQQRRPLGFWKVLLTPPSRLAMRPW
Download sequence
Identical sequences ENSSARP00000006492 ENSSARP00000006492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]