SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Sporo1|31854|estExt_fgenesh1_pg.C_20389 from Sporobolomyces roseus IAM 13481

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sporo1|31854|estExt_fgenesh1_pg.C_20389
Domain Number 1 Region: 57-199,236-276
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 7.14e-39
Family AlkB-like 0.00074
Further Details:      
 
Domain Number 2 Region: 554-620,687-856
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.57e-17
Family Tyrosyl-DNA phosphodiesterase TDP1 0.0059
Further Details:      
 
Domain Number 3 Region: 445-577
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.0000000000033
Family Tyrosyl-DNA phosphodiesterase TDP1 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sporo1|31854|estExt_fgenesh1_pg.C_20389
Sequence length 862
Sequence
MDHPDNSPPPSAASLPLESPKVTKRVAPGKNPTSKPAKRARLTVGADETTQVSNLNQHRL
PFADGDVFYVEDFIDPNLAQQWHDELLKVEGWYQPTLKMYGKEITQSRKIAAFATDPDLT
VKYSGALVAMKYEYPPLLRKIQDMVEDKLGVKFNHCMANCYENGSVYIGNHRDNRENRVI
ASVSLGAPRTFIMEHDKPPPGASAHVKKPVKTSKSKTCRPSPSGVAPSPASTAAHNGEGE
ESLYYKKWTLENGSLVVMQGETQSKWKHQIPKEAKALLDYYSTRTGGSRSPQPTHSSSSR
KRTEAKEPTQHRARRGGDPESKKLDDQLDLDLLKAQMFDMAQKLWLSDSRDGALSKACRP
LDSRPTGSDFCEVYRADGGKRAYQLLLGQPMSNDPFVFRACLQAGIEQDCHKPPNLNAPE
SEVVAPLLSKIYQEVIGRNYLAIHPKCAGCSHSKIFVVRYIGFVLVVITSANTMKLDMEL
CDNILDELGEKRKQHWYIQAFPELSRRELENKKRTKPPASEFERTLLYHLNELECPEEFI
DLLETYDYSLASDINLVVSSPGVASSNEFDLLGIGRLAKIARDLLKDEERDSIRFEVCCG
SLGAMRKEWLDSVEWLLRGKDPARLERRLRRRLKKEKEKQLREDEEEEKQNRRGETEPKK
KKLKRVVQEEEQEDGEEGSDETEDPVWKIVFPPKGYVATLSPEVKETASNISSYWKTENW
STAPRRTKRLFHQYRSKERGRLFHEKSILWLSRDSDQKPEPSSSSSSSRSPPPPLLFYLG
SHNFSSAAWGTPAVYRSSNQPGLKSENINNYEIGIVVKGDKIVSMLEKGSIWEDIVTYER
PFERFGPEDIPWVSPTWVKETE
Download sequence
Identical sequences jgi|Sporo1|31854|estExt_fgenesh1_pg.C_20389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]