SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Monomethylamine methyltransferase MtmB alignments

These alignments are sequences aligned to the 0048443 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                             10        20        30        40         50        60  
                                              |         |         |         |          |         |  
d1ntha_                              TFRKSFDCYDFYDRAKVGEKCTQDDWDLMKIPMKAMELKQKYGLDFKG.EFIPTDKDMMEKLF
FQd_gi|410670879|ref|YP_006923250.1| ------------------------------------------------.--------------
FQd_gi|410670915|ref|YP_006923286.1| ------------------------------------------------.--------------
FQd_gi|410670881|ref|YP_006923252.1| TFRKSVDCYEFYDRAKKGEKMSQDDWDLMTIPMKSMELKQKYGIDFKG.EFVPTDKDMMEKLF
FQd_gi|410670918|ref|YP_006923289.1| TFRKSVDCYEFYDRAKKGEKMSQDDWDLMTIPMKSMELKQKYGIDFKG.EFVPTDKDMMEKLF
FQd_gi|410670878|ref|YP_006923249.1| ---KMQNMYKYLKSAIEGVNRTEKQHDLL-VFKKSEELALKYDIKYDGkSFVPDDLELADATF
FQd_gi|410670880|ref|YP_006923251.1| ------------------------------------------------.--------MMEKLF
FQd_gi|410670917|ref|YP_006923288.1| ------------------------------------------------.--------------
FQd_gi|410670916|ref|YP_006923287.1| ------------------------------------------------.--------------


                                           70        80        90       100       110       120     
                                            |         |         |         |         |         |     
d1ntha_                              KAGFEMLLECGIYCTDTHRIVKYTEDEIWDAINNVQKEFVLGTGRDAVNVRKRSVGDKAKPIV
FQd_gi|410670879|ref|YP_006923250.1| ---------------------------------------------------------------
FQd_gi|410670915|ref|YP_006923286.1| ---------------------------------------------------------------
FQd_gi|410670881|ref|YP_006923252.1| KAGFDMLLECGIFCTDTSRVVKYTEDEIWDAINNVQKEFVLGTGRDAVNVRKRKVGDKRKPII
FQd_gi|410670918|ref|YP_006923289.1| KAGFDMLLECGIFCTDTSRVVKYTEDEIWDAINNVQKEFVLGTGRDAVNVRKRKVGDKRKPII
FQd_gi|410670878|ref|YP_006923249.1| EAGIELLHSVGVYCKSTGKVIQIDEEDILKSL-NVTNPLEIGRLKEKVTVPHRYPMASIPPVI
FQd_gi|410670880|ref|YP_006923251.1| KAGFDMLLECGIFCTDTSRVVKYTEDEIWDAINNVQKEFVLGTGRDAVNVRKRKVGDKRKPII
FQd_gi|410670917|ref|YP_006923288.1| ---------------------------------------------------------------
FQd_gi|410670916|ref|YP_006923287.1| ---------------------------------------------------------------


                                       130       140       150       160       170                  
                                         |         |         |         |         |                  
d1ntha_                              QGGPTGSPISEDVFMPVHMSYALEKEVDTIVNGVMTSVRGKSPIPK...........SPYEVL
FQd_gi|410670879|ref|YP_006923250.1| ----------------------------------------------...........------
FQd_gi|410670915|ref|YP_006923286.1| ----------------------------------------------...........------
FQd_gi|410670881|ref|YP_006923252.1| QGGPTGSPISEDMFMPVHMSYALEKEVDTIVNGVMMTVRGKPTIPK...........SPYEIL
FQd_gi|410670918|ref|YP_006923289.1| QGGPTGSPISEDMFMPVHMSYALEKEVDTIVNGVMMTVRGKPTIPKspyeinptipkSPYEIL
FQd_gi|410670878|ref|YP_006923249.1| IGGPMGGSISEENFLYINLSAVLENVVQGIYSGAMKQFCGEYIRPK...........SPLELL
FQd_gi|410670880|ref|YP_006923251.1| QGGPTGSPISEDMFMPVHMSYALEKEVDTIVNGVMMTVRGKPTIPK...........SPYEIL
FQd_gi|410670917|ref|YP_006923288.1| ----------------------------------------------...........------
FQd_gi|410670916|ref|YP_006923287.1| --------------MPVHLSYALEKEVDTIVNGVMMTVRGKPTIPK...........SPYEIL


                                     180       190       200       210       220       230       240
                                       |         |         |         |         |         |         |
d1ntha_                              AAKTETRLIKNACAMAGRPGMGVKGPETSLSAQGNISADCTGGMTCTDSHEVSQLNELKIDLD
FQd_gi|410670879|ref|YP_006923250.1| -------------------------------------------MICSDSHEVSQLNELKIDLD
FQd_gi|410670915|ref|YP_006923286.1| -------------------------------------------MISSDSHELSQLNELKIDLD
FQd_gi|410670881|ref|YP_006923252.1| AAKTETRLIKTAAAMAGRPGMGI----------------------------------------
FQd_gi|410670918|ref|YP_006923289.1| AAKTEARLIKTACAIAGRPGMGI----------------------------------------
FQd_gi|410670878|ref|YP_006923249.1| AVLKAARNERLATKIGGREGLALMGPSTPTLPTSYLLVSSDELYSSADPQEVY-MDDLKTDYE
FQd_gi|410670880|ref|YP_006923251.1| AAKTETRLIKTAAAMAGRPGMGI----------------------------------------
FQd_gi|410670917|ref|YP_006923288.1| -------------------------------------------MICSDSHEVSQLNELKIDLD
FQd_gi|410670916|ref|YP_006923287.1| AAKTETRLIKTAAAMAGRPGMGI----------------------------------------


                                            250       260        270       280       290       300  
                                              |         |          |         |         |         |  
d1ntha_                              AISVIAHYKGNSDIIMDEQMPIFGGYAGG.IEETTIVDVATHINAVLMSSASWHLDGPVHIRW
FQd_gi|410670879|ref|YP_006923250.1| AISVIAHYNANSDIIMDEQMPIFGGYAGG.IEETAIVDIATHLNAFVMSNATWHLDGPVHIRW
FQd_gi|410670915|ref|YP_006923286.1| AISVIAHYNANSDIIMDEQMPIFGGYAGG.IEETAIVDIATHLNAFVMSNATWHLDGPVHIRW
FQd_gi|410670881|ref|YP_006923252.1| -----------------------------.---------------------------------
FQd_gi|410670918|ref|YP_006923289.1| -----------------------------.---------------------------------
FQd_gi|410670878|ref|YP_006923249.1| TLSKCIFHQEHGNHYISGQVPVFGGPCIGsAEGLAIIDVAETLQSKVLAHSSIHGSGAVHSET
FQd_gi|410670880|ref|YP_006923251.1| -----------------------------.---------------------------------
FQd_gi|410670917|ref|YP_006923288.1| AISVMAHYQGNSNIIMDEQMPIFGGYAGG.IEETAIVDIATHLNAFVMSNATWHLDGPVHIRW
FQd_gi|410670916|ref|YP_006923287.1| -----------------------------.---------------------------------


                                          310       320       330       340       350       360     
                                            |         |         |         |         |         |     
d1ntha_                              GSTNTRETLMIAGWACATISEFTDILSGNQYYPCAGPCTEMCLLEASAQSITDTASGREILSG
FQd_gi|410670879|ref|YP_006923250.1| GSTNTRETLMIAGWTCATISEFTDILSGNQYYPCAGPCTEMCLLEASAQAITDTASGREILSG
FQd_gi|410670915|ref|YP_006923286.1| GSTNTRETLMIAGWTCATISEFTDILSGNQYYPCAGPCTEMCLLEASAQAITDTASGREILSG
FQd_gi|410670881|ref|YP_006923252.1| ---------------------------------------------------------------
FQd_gi|410670918|ref|YP_006923289.1| ---------------------------------------------------------------
FQd_gi|410670878|ref|YP_006923249.1| GSSSAKEILWASNLASLAISRNMNYYTARYYWNAAGICTEMMFYETAAQAIGDTVCGRDILMG
FQd_gi|410670880|ref|YP_006923251.1| ---------------------------------------------------------------
FQd_gi|410670917|ref|YP_006923288.1| GSTN-----------------------------------------------------------
FQd_gi|410670916|ref|YP_006923287.1| ---------------------------------------------------------------


                                       370       380       390       400       410       420       4
                                         |         |         |         |         |         |        
d1ntha_                              VASAKGVVTDKTTGMEARMMGEVARATAGVEISEVNVILDKLVSLYEKNYASAPAGKTFQECY
FQd_gi|410670879|ref|YP_006923250.1| VAAAKGVVQDKTTGMEARMMGQAAKATAGMEIEEVNKIIDNLVKMYEKNYATAPQGKTFQECY
FQd_gi|410670915|ref|YP_006923286.1| VAAAKGVVQDKTTGMEARMMGQAAKATAGMEIEEVNRILDNLVKMYEKNYATAPQGKTFQECY
FQd_gi|410670881|ref|YP_006923252.1| ---------------------------------------------------------------
FQd_gi|410670918|ref|YP_006923289.1| ---------------------------------------------------------------
FQd_gi|410670878|ref|YP_006923249.1| PAGARGGVPDHSSGLESRFMGEIAQMATHLSLSEANRLVAKIYSRYEDKLSNPPAGKTFDKCY
FQd_gi|410670880|ref|YP_006923251.1| ---------------------------------------------------------------
FQd_gi|410670917|ref|YP_006923288.1| ---------------------------------------------------------------
FQd_gi|410670916|ref|YP_006923287.1| ---------------------------------------------------------------


                                     30          440       450          
                                      |            |         |          
d1ntha_                              DVKT...VTPTEEYMQVYDGARKKLEDLGLVF...
FQd_gi|410670879|ref|YP_006923250.1| DVKT...ITPTEEYVTVYEGARKKLENLGLVF...
FQd_gi|410670915|ref|YP_006923286.1| DVKT...ITPTEEYVTVYEGARKKLEGLGLVF...
FQd_gi|410670881|ref|YP_006923252.1| ----...-------------------------...
FQd_gi|410670918|ref|YP_006923289.1| ----...-------------------------...
FQd_gi|410670878|ref|YP_006923249.1| RIRSeydLEPTEEYTSIYRKV-----------sye
FQd_gi|410670880|ref|YP_006923251.1| ----...-------------------------...
FQd_gi|410670917|ref|YP_006923288.1| ----...-------------------------qp.
FQd_gi|410670916|ref|YP_006923287.1| ----...-------------------------...


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0048443 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Selenomonas ruminantium subsp. lactilytica TAM6421
NoYes   Desulfotomaculum acetoxidans DSM 771
NoYes   Acetohalobium arabaticum DSM 5501
NoYes   Thermofilum sp. 1910b
NoYes   Thermofilum pendens Hrk 5
NoYes   Methanosalsum zhilinae DSM 4017
NoYes   Methanohalobium evestigatum Z-7303
NoYes   Methanosarcina acetivorans C2A
NoYes   Methanosarcina mazei Go1
NoYes   Methanosarcina barkeri str. Fusaro
NoYes   Methanohalophilus mahii DSM 5219
NoYes   Thermoplasmatales archaeon BRNA1
NoYes   Methanomethylovorans hollandica DSM 15978
NoYes   Methanolobus psychrophilus R15
NoYes   Methanosarcina mazei Tuc01
NoYes   Candidatus Methanomethylophilus alvus Mx1201
NoYes   Groundwater dechlorinating community (KB-1) from synthetic mineral medium in Toronto, ON, sample from Site contaminated with chlorinated ethenes
NoYes   Guerrero Negro salt ponds hypersaline mat 03(I) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 04(N) (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP15 from Mushroom Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP18 from Washburn Springs #1 (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methane enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methanol enrichment (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Olavius algarvensis endosymbiont metagenome Delta1 (meta-genome)
NoYes   simHC - Simulated High Complexity Metagenome (meta-genome)
NoYes   simLC - Simulated Low Complexity Metagenome (meta-genome)
NoYes   simMC - Simulated Medium Complexity Metagenome (meta-genome)
NoYes   Soil microbial communities from Minnesota Farm (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 1 Maryland Estuary CO2- (Maryland Estuary ambient) (meta-genome)
NoYes   Soil microbial community from bioreactor at Alameda Naval Air Station, CA, contaminated with Chloroethene, Sample 196 (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Uniprot 2018_03 genome
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]