dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|146304889|ref|YP_001192205.1| (Metallosphaera sedula DSM 5348)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment 30S ribosomal protein S9 [Metallosphaera sedula DSM 5348]
Sequence length 137
Sequence
MSTESRVIITNSRRKMARAKCYLFPGKGRIFVNDVPIELIPVEVIRMKIMEPMLLAGEGI
TSKVDVKIYTYGGGIMGQADAARMALARALVRFTGSQELKELYKKYDRTMMAGDPRQTEA
EKWMRYSARRWRQKSYR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]