dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|229581478|ref|YP_002839877.1| (Sulfolobus islandicus Y.N.15.51)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment tRNA pseudouridine synthase D TruD [Sulfolobus islandicus Y.N.15.51]
Sequence length 377
Sequence
MIPHEIDIALGMERYYYEDWNEIDGTIERPNGFKVVEEIDFKPAHEWKGEEKGKYAVYLL
TKWGIDHFSVLSEIQKVLHSKVNYMGIKDASAITSQLVYITLTKKQELINEYKSNSFILK
FLGYSSMKFNHTGNIFEISLSTSNFDLVVERVRQIEKNPYLPAFIGYQRFGTRRPVTHLI
GKYLLKRDWEKAFYLILTYPFLSESKEIIEIRKLIIKGDFNEAVRLIPSKFKQEKLLLKN
YMKFNSYYLALKNSFIPISLYLDAYQSYLFNMYLSRRLDKYKNSDDKDNLFIRIPIYFND
CDDICKEIYLNEEIEKNFFKLPEFKISLKSLNRKAFMNIRNLKINEETRTISFVLDRGMY
ATVLLREILRGDPRKFT

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]