dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|220930600|ref|YP_002507509.1| (Clostridium cellulolyticum H10)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein Ccel_3240 [Clostridium cellulolyticum H10]
Sequence length 2073
Sequence
MRKKSLVMLSLAIVLSLLLTSISYADVTSSYQNPLMRGADPTIARAADGFYYSCFAVDND
IYLKKADTILGVGTAKSRLAWDKPADFGYVWGPYIYRLDGKWYIYFTSAPENSFGYGHPS
SYVLENTSPDPFEGTWELKGVSANADEDGQVTDKPGLLNTQGYGLACGVVTMGGKTYFTY
TKYFYYPDPNDPTKEKFDECPTIVEMENPWTLKGTEGTLARPVYDWEKQGDSINEGAAVV
ERNGKVYFAYSASSFMNDNYCVGVSTADAQSDLLQESNWTKNPEPALAKSPENSSFGPGS
PLFVKSEDGTEDWLIYHGGPVGGQTGSNRWVRAQRINWNDDGSINLGIPSNPGTVLDRPS
GEEKSETYEAEDASFAGVTRTILSDSSKASGSGVMKYDNSSNGYVEFTVDANMPGSYSLN
FRYNNSTGSNITMSLGVNQNSSRELSFEPNGSNSTNYDLLRVHNVQLNAGHNKIRLSSSE
ANGLVLDAMIIKKSVLYEAENAALSGGALVSTEHSGYSGTGFVGGMYTEGTSAEFTVDAP
YAGNYSVNLRYCNGFSNIDKTLSMYVNGVKVKQIDLFSFGDWSKWSERYDNIELRAGSNT
ITYKYDSGDGGNVNLDYITVTEATTRHYEAENAVLTGNAQKSTDHTGYTGTGFVGGFWTE
GSVEFSVNVETAALYDVKLKYALGFPEDRTMSIYLNGSKVKQVTLPSTGGWDTWSEYLET
LSLNKGNNTISIKRDSDDSGDINIDSIHLDRRISWKYQAEDATLLGGAHPVDDHLWYEGT
GFAGGFETLYESIQFNVNVPNTATYTTTLRYSGAQENDITMSLYVNGTKIKQVSLPPTAD
WDSWGEATETVNLKAGKNVIEYKRDDGDTGRFNIDSMTIDKYSVGDTDLKNRGIVSGTVY
TIKAKHSGKALDVSGYSSEPGALVDQWTYVGGNNQRWEIIDLGTGYYKIKSAHSGLVLDI
VEGSPDMDLCQTTSSPAETQQWILEKVGGYYKIVNKSNGMVLDVSEESYDNGKKVHLYSY
VGKANQLWKIDVASANELFIPVTGITDVPVTATAGTDLTLFANVLPYNATNKSIEWRVKD
AGETGATISGNTLSTVGAGTVLVTAVITDGMPDDNAYTQDYIIQINAVNHAPTAKANIPV
AAVAADDSVSFIASDIAEDEDGDTLTIAEIKTSPDSAMASAILDNGTVTVSGVAPGSTDA
TLVVSDGRGGTVEINVPIEVAAAPDVKIDISQSPVKTIFNALTFGLFFNDSIDVSLSSGK
TEIDHFEYQIVGAESPFDSNGTWTTGNSFSVEPDFMGRVYARAVFTDGAVTETYIKALVV
DKTKPEIGAVYDKDNASIAVTVSDISAGIDTITYQVGSGEVKSVNLTPTAEKDITFEYSF
TISSLPEGQYDVVINAIDNSDNAADTKTLNIVNNGVASAEISPVSESFDINVPADVSTTI
TWNDASSVTDVVYGGNPVTSDSYEVSGDTLTLKSSYLASLGLVNGDTSEFIINFDRGNPV
TFVVSIIDSSDPTPVNRSISVQNDGNGTASANVTSATEGTEVTLTATPNEGYRFKEWQVI
YPTGLAITGNTFTMPNGAVSVKAIFEQNPVVNYTLSVNGSYSNESGAGSYVEGSTVTINA
GSRSNYTFRGWSSGDGVTFANANSTTTTFTMPAKNVTVTASWTYNGSSPYNGTIPSQPAT
KDYTADIKVSGASGNSTLPITVDAKTGTARLDTASRNELVANGGISVITVPSIPDVDTYS
VGIPVPYLSTADWQGSLRVSTNRGSITVPSNMLTGIAEAAGTKAEITIGKGDKATLTEAA
KTAIGDRPLIQLTMYIDGKQMEWNNPNVPVMVTIPYTPSAEELANPERIIIWYIDDNGKA
VAVPNGHYDPASGTVAFDTTHFSSYAIGYSDVSFNDVTENAWYNKAVSFIAARDITAGTG
NGYFSPNAKLTRGEFIVMLMKAYEIAPDGKQSSNFEDAGNKYYTGYLAAAKRLGISEGIG
KNMFAPEKQITRQEMFTMLYNALKTMDKLPQGDTGKSLSSFDDEEMVASWARDAMTLLVE
TGIVGGNAGQLTPASTTTRSEMAQVLYNLIYKN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]