dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|123965782|ref|YP_001010863.1| (Prochlorococcus marinus str. MIT 9515)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment glutamate-1-semialdehyde aminotransferase [Prochlorococcus marinus str. MIT 9515]
Sequence length 413
Sequence
MPGGVSSPVRAFKSVGGQPIVFDRVKGPFAWDVDGNRYIDYIGSWGPAICGHAHPEVITA
LQEAIEKGTSFGAPCVQENKLAEMVIDAVPSVEMVRFVNSGTEACMAVLRLMRAFTGRDK
VIKFDGCYHGHADMFLVKAGSGVATLGLPDSPGVPRTTTANTLTAPYNDLEAVKKLFSEN
PDAISGVILEPIVGNAGFITPEPGFLEGLRELTTENGSLLVFDEVMTGFRISYGGAQEKF
GVTPDLTTLGKVIGGGLPVGAYGGRKEIMSMVAPSGPVYQAGTLSGNPLAMTAGIKTLEL
LKQEGTYEKMGLATSRLIEGIMQSAENNGIAINGGSVSAMFGFFLCEGPVRNFEEAKTNN
SELFGKLHREMIKRGVYLAPSPFEAGFTSLAHSEEEIDRTIEAFDQSFSVIKN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]