dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|226357571|ref|YP_002787311.1| (Deinococcus deserti VCD115)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment peptidase [Deinococcus deserti VCD115]
Sequence length 590
Sequence
MLRAEERQLLDAVTLDRPWELITTFSTLKREHPNDVRRAAEHIERHLRELGIPVEIHQPE
LFLSLPGQASVSVGGTTFSAKPMAMSAIFPEGLTAPLVYQPSQYAANADDMFSSSLLDGE
VDVAGKIVVTEGFGMPGKIRELEHRGALGVIAINPGARAHWGICTSIWGTPDLHDLPRKP
RVAVANVNRPDGDRLIDLARAGAEAVFKTNLEEGWFVSPVPVVTIPGTEDPKSFVLLHGH
YDSWDYGVGDNAVGDATLLEVARNLWNNRAQLRRSVRIAWWPGHSTGRYAGSTWFADHFA
LELYRNCIAQINCDSPGCRWATEYKDVSVMAEATAWAGDIIRDVTGQDMQAERPVRAGDY
SFNNIGLSGFFMLLSTMPDDLRAEKDYYAVGGCGGNIAWHTEDDTLEVADRDILLKDIKI
YLLSAYRTANQTIIPFDYVQTLNEFDQTIAEYGEGIGTAVDLGRVRDAVETLRTDVRELM
RAARSLNGESLTSPQVRRVNFALITVARHLVQANYTRSPAFFHDPAEHVPPLPDLAVLQT
LQSADDYQRGFILTHATRGLNRLLAHLGDAQVAVRDALNHLELPVKGGTS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]