dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|226357780|ref|YP_002787520.1| (Deinococcus deserti VCD115)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein Deide_3p00810 [Deinococcus deserti VCD115]
Sequence length 602
Sequence
MELLSALRLAHQPHHVLAYVSESPQTRAALRTSIVRAAGPGCAARVRSAYKTAYFWITEE
VQPLWRRAQADRVTLTYPVLSEAPQGRFLQEAYPLAAVFEREGVEAEFVPGPVGRPYYQA
TLWRGERELWHGTCFTPLFQRQAPDGRMVLGPTGWLTVQAEGADVLDQRLETDGEAFWDW
YVATVLPAVLELADRRDDGLVFRNLAVTLQLSEPDLALDVLDERISMTEALTEEVYFGTV
DALKRHTSTPPGARTLTPGRIVPVAHAVPGQDGWARVTLTEWASSPAELHRPGASHSVTA
DPESVLQDRPAPPGQIWANARAAADRHQLEWHVPAHSVDGRPVPAVLRSTPGAAGSVLIT
AGQHANETTGPVAALNLLSHLAGMPVNFALLPLENPDGAFLHRALTQLAPNHMHHAARYT
SLGDDLEARLRQGDRRWEAGARAWAQEQVGANLHLNLHGYPAHEWVRPYSGYAPHGFESW
ALPAGFITIVWYWPGHDKPARLLAEAIAQRLQQEPEVVQHAQAALRASTAHVLTPHYELI
GGLPFILTEQPSALCPLTVITEAPDETIYGARFRSCVQAHLSVCLAAIGHTLRGDGQPES
CT

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]