dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|119383072|ref|YP_914128.1| (Paracoccus denitrificans PD1222)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment GntR family transcriptional regulator [Paracoccus denitrificans PD1222]
Sequence length 218
Sequence
MAEAREPAPSLAEEIAARLRDQVTGGALVPGQRLSEARVAAELDISRNTLREVFRLLTRE
GILRHEPNRGVFVAVPSMASILDIYRVRRLIEVPALAQAWPGHAAVARMRSAVARATELQ
RIPDWRGVGSANMEFHAAIVALTDSPRLIQFFTQIIAELRLAFGLLDSPELLHRPYIPRN
AEILGRLEAGDPAGASRMLEDYLNQSERAVLEAFARLG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]