dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|237785665|ref|YP_002906370.1| (Corynebacterium kroppenstedtii DSM 44385)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment proteasome assembly chaperone [Corynebacterium kroppenstedtii DSM 44385]
Sequence length 361
Sequence
MTMDNDETMYELEYPEPETQSDASNGLSLVVALQGYADAGQAIDNAGSHIKAALEHAPLA
TFNNDLLIDYRSRRPAVHIVDNELAPAEKTELSLDVVRDNAGIPFLLLSGPEPDLRWSAF
TEAVTDLSKRFKVTKAVSLYSAPMPVPHTRPLIVTQHGSYKSDPLRYPRFDGRITVPGSA
QLELEMKMAKEGIETAGFTAHVPHYIAASEYPSAVVKLLRAVEETAGVSIPLQALERESE
KVERELEEQVEESGEIAAVVHALEAQYDQETARYRERHDRGLLSSDGEVPTGDEIGAELE
KFLAQVNRDKDTQDIGTGDDGVEDIGAESWDESDSPRSDDDDDNSGDRRPHSDGGDDSDE
D

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]