dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|258515215|ref|YP_003191437.1| (Desulfotomaculum acetoxidans DSM 771)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein Dtox_1979 [Desulfotomaculum acetoxidans DSM 771]
Sequence length 2031
Sequence
MSRLLTGQSGRNVKKGISLLLALVMLLSLLPVQVIASEGEPELTATGINLSEGVIAGQPA
SVTAGVYNTGNANEDEFSGVLHIAEQETPYEEQTDSTDAISETGENNNEQNIAANVLKES
GTEALELVSLSPANGATGVAVDAPLTLTFNRPVEANPDYSSGYLGIKVAIIQESDGDWYG
GEANVLKFSTENPEQVTVDIADSAPYGGELKPGESYTVYIDNDCIRAKDTGETFKGIMGG
AMDPDTDICWSFRTGEALSARINGGEAVGGNSLQAIVEAAEISPAEVTSVEVTRGAVSAD
DLAYIESSLINLETLTASYTVNINDGVLPAEAFIMHAALRTVNLPSVVSIGENAFGYCGN
LKTVRLNNLRSMGDYAFTCCSSLDTLVVPNLQDVSDSAFSLCLSLEYVYMPKAVSMSGMT
GFVLSGSLAGAWFPKLGNIAPYAFEGDTSFREMYLETAPFHYSEGLGGAFLDLPADRIVY
VPEDYVAAYLGYADDDPEDGKWYGWTVKSFAESSTLGAFVEVLINQLPENDRLTYGDIPQ
VQSLRAAYNRLTAVQRESVSGAVYEKLTAAEATLLGQGNTIVEGIINRIDALPSTVTMED
KAEIRSIRQAYDNLPEMYRELITNLTALIAAEEVIAELDIKDVEQLIERLPSADELTLAN
EADVQAARSAYDALIAGQQASVSNYNVLLAAEDAIARLGFKSVEQLIEQLPSPDDLTLDN
KSAVQAARNAYDALSAEQRVAVGNYELLQAAEAKIYDLEAQEAARAVDSLIDELPSAQEA
QIADKTAALGARAAYNALNDQAKTYVAALQKLTDVLEAISGLERQTLKGGAVNDRISALP
AVEALTLTDKAAVLEIRADYDALTEQEKALVTADNLSKLQEAEAKIARLESENPASSVTV
TIEKFTLGQGFVRKPVQVSINAGENGAAVVTRLLGMGNYTNTGSIDSAFYLASIKDNGSA
QADIPAYIIDAITAGEGTVGTRANANYLGEFDYYHTSGWMYTVNNILPNYGLSDYIPQDG
DVFRLQFTLYGYGGDLGFGDNKLIDTADKGALIKKLAAIDASEDRLTMLADPVYKGYYDK
ALLVLQNLQASQIQVDAALADLNTAPNPPSSLGKVTVTVRDVVDRKWTTWNYHGGETTVE
QLSGLGDYQESFGVLLEDVEVSITPGMTVRQAVAAALRSRGYQVTGTPTYIKGIGPVTSD
DYTRTVAHLSENDAGSRSKWVMSQNDWCIWDTSQAYPVEDGDVLKLEYSVDGGIDIHCHP
GSGSYLTVNFTIDGTTYDVSSSAGYYMVPAGTEEITVSAERLLRYAGKDIDRYLVVELQS
EGVSVLNKPATFAVSDGQVIKAIIDDRYNSPNTDTNSGKTYTYTIEIKRTPAQVDAMIAA
IPGLENIVYADKAQIEKVRRCYNYLTVGEKTGVAGLAVLEAAEARITAIYDVNRAEANRV
IDLIKVLPNTMKNEVVTLEHRAAIEYARAQYEALTEDQKVLCSSWLGYMERAEAALAELL
DAQQAVEGVPKDYSKDFLLSTMALNLSVGEEEEMVMFDTPRVGSDNCAYNLDDLILEYSG
QEGVFEIEKRVVNKDGQDLTKYYVKGLSDGVGYFTVKYLGYSGQIPVIPVCVQASGSRSP
ALSTDIDEQVSKYDTMYFTEEEGSYPFTFTAESEDGASVSAMVYGVMYEPNAGGVFTVPL
RDRYNPIIVTAAKDGQTTSIAYGIRAKVIALKITNESRGGNVFYQGDTVSIGCTGVMLPV
PKVSRIYNPASSRLEYHTDMPRYDLVGSSSSQYAAGALTFELTGYGDIALTGGHVHLSWF
GSGLYAETPIGGAPPNLNADQIANNFSSLPDIRLTVIRDPYYAPEDVLSAGMVGASTIHA
GDEVTVSIPGIDTDMLKKNHTTNSGEIVDLLDSYTVFATDIPGLKQVKSVNVKTTDQLKN
LKTITFTVPENTPSGDYKLKGGYIWVKYGPTWWTHEKEYYVTKMEDVDLTVTGETGAGDV
NQDGKVDVQDMILVGQHFNERGAAGWISEDINKDGEIDVLDMIFIGQHWKD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]