dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|222526355|ref|YP_002570826.1| (Chloroflexus sp. Y-400-fl)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment peptidase S8/S53 subtilisin kexin sedolisin [Chloroflexus sp. Y-400-fl]
Sequence length 1115
Sequence
MSRLFSRNYLVALTLLLSLVLAGILPLRPVEAQPRPDRPTPGTPLTIEPLTASSREDVAV
NKNLALSRDGTLASVFLKIDSPSLASFMAQNGITDINAPAAQDYLRQLNAELDALIAQAQ
QRIPGLIVTHRFDLIIGGVSVAAPVSHLDQLRRLPNVVEVINDRIERIETYRTPAFIGAT
TAWNRGGGSAFAGEGVIFGVLDSGVWPEHPSFSDPDPLGKPYAPPPPAPGNPGGLRACNF
GSATPGDAPFTCNNKLIGSYRFMSAYDFFVGTQPYEFRSGRDDDGHGTHTASTAAGNRGV
PASDGSRVFGTISGIAPRAYIVNYKVCGELGCFTTDSAAAVQQAIRDGVHVINFSISGGT
NPYSDIASLAFLDAYNAGILVSASAGNSGPAPDTVNHREPWVATVGASTSDRSYLSTLTV
QGSSGTFTAVGASSGAGISTPAPVVVNTTDPLCLNPAAAGTFTGQIVVCERGIIARVAKS
ANVAAGGAIGMILYNPTPSSLDADFHSIPTVHIQNTDGSALLAFLTANPGATATFTPGAP
GPIQGDVMAGFSSRGGPGQTLGISKPDVTAPGVNILAGYTAIEYGQAVPQFAFLSGTSMS
SPHNAGAAILLKWLNPTWTPGQIKSALMTSAKAAGVYKEDGVTRFTPFDAGSGRIDLRKA
WDPGLTFDETGANYLALQNELWKANYPSLYVPRMPGLITVSRTVREVSGYNSFYKSTISY
QAGQPRDFKVIVPKEFFVPANGTYTFNITVDARDVPLGQVRHAVVIFTERNGCQVRFPVT
IVRGEPDIRMEKQCDPATLALRGTTDCTISITNTTFNDVTVTLNDTMPKQLKLVSGSVTG
GATETSNGLTFSGTLTGASPPNISAGRLTFNGYLSLASLGASPNVSLGDETIANFTLSRP
FVFGGQTYNTIGMVSNGYAVIGGGTAADVQYINRTFPNPARPNNTLGAFWTDLDGSAGGG
YYAYLVGFGPCSNPANACWLILEWENAPNWGDGELNTFQIWIGLNGVEDITYSYGPTLSD
GDSGYVTVGAENAFGNRGANIYSNDGFGPIVGTIPTANSNDVYIATTPGTPGQTITIGFR
AQGVRLGRWTNYAELTSPSFFGTYIDPFSGEVVRP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]