dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|557693915|ref|YP_008796969.1| (Candidatus Caldiarchaeum subterraneum)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment small subunit ribosomal protein S5 [Candidatus Caldiarchaeum subterraneum]
Sequence length 204
Sequence
MSEWVPRTRLGRLVQEGKINSLDQIFQMHGRVLEPEIVDRLLPNLEQEVIDVKLVQRQTD
AGEKTRFKALVVVGNRDGYIGIGTGKSTQVVLAIEKAIRNAKLNIVPVVRGCGSWECACG
EPHSLLVKSEGKYGSVRVQLLPAPRGLGLVAGESQKVVLALAGVKDCWTRSFGETRTSLS
VVGAVYEALKRTAEAVLPSLWRTV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]