dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|258652964|ref|YP_003202120.1| (Nakamurella multipartita DSM 44233)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein Namu_2785 [Nakamurella multipartita DSM 44233]
Sequence length 286
Sequence
MSEFMPLRNPVMIAAFEGWNDAGDAASAAVEQLGLIWDAVPLTELDPEGFYDFQVTRPTV
RLVDGVTRTIEWPTTRLSVCRLPDSPSDVILVHGIEPNFRWRAFCDELLKIAVDHQVSKV
IGLGALLADVPHTRPIQVTGSAHDEQTAVSLGLTRSRYEGPTGISGVFQDACVQAGIPAL
SFWASVPHYVSQAPSPKATLALLHRVEEVLDVAVPLGNLPAQADEWEAEVSQIASEDEEI
SEYIRSLEEREEQDEPLKPASGESIAAEFERYLRRRGPKPGGDSWR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]