dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|478467875|ref|YP_007742748.1| (Chlamydia trachomatis L2b/Ams4)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment transcription antitermination protein NusG [Chlamydia trachomatis L2b/Ams4]
Sequence length 182
Sequence
MFKWYVVQVFTAQEKKVKKSLEDFKEASGMSDFIQQIILPSENVMEVKKGEHKIVEKYIW
PGYLLVKMHLTDESWSYVKKTQGVVEFLGGGAPVALSEEEIKNILADLEEKKSGVVQKHK
FEVGSQVKINDGVFVNFVGVVSEVFHDKGRLSVMVSIFGRETRVDDLEFWQVEEVVPGQE
SE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]