dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|118471616|ref|YP_887078.1| (Mycobacterium smegmatis str. MC2 155)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein MSMEG_2746 [Mycobacterium smegmatis str. MC2 155]
Sequence length 348
Sequence
MADNENPQQRYQPDQSGMYELEFPAPQLSSSDGRGPVLIHALEGFSDAGHAIRLAAEHLK
KSLDTELVASFAIDELLDYRSRRPLMTFKTDHFTAYEEPELNLYALHDTVGTPFLLLAGL
EPDLRWERFITAVRLLAEQLGVRQVIGLGTIPMAVPHTRPVNLTAHSNNKELIAEHTPWV
GEVQVPASVSNLLEFRMAQHGHEVVGFTVHVPHYLAQTAYPPAAEALLAEVARTGSLELP
LAALSEAGAEVYTKINEQVEASPEVAQVVSALERQYDAFIAAQENRSLLARDEDLPSGDE
LGAEFERFLAQQAGEKFKDDKYKDGHGEGFGGRIRGTVTTTDDVPDQG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]