dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|154150300|ref|YP_001403918.1| (Methanoregula boonei 6A8)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein Mboo_0757 [Methanoregula boonei 6A8]
Sequence length 459
Sequence
MKWKLGILSCLLILLMVSAVYADDSSSTTSSTSSSTTSSSSTSSSTSTVDQAALVYVSNI
SLDTNEYFPDDEGTLSVTLTNGGTSAIGLENPTLISPHISTENNDWVGMSFVGAGSSLTY
SIPFTVKPPCGTYFALFTIGTQNGNAIHYPVKIKISSNTLTGAITSQPTSYAPEAEQNVT
LTLMNTRSGDIKNIVITPVGSGIDADPSVELIPTISAGSSSAVTFGITPHQASDLTFNVS
YQDGDNTHYTDVVLPITLGQDKTAAVPIVNNVELTSSGSTQEITGDVTNAGITDAYGVTV
TVGSPAIATGTYPVYAIGSIASDDSGSFDVTFSANDLSAVPLVVSWKDSSGNDYNITKTL
DLSSGTSSTTGSSTSKTSTTSSSSGSMSGGPGGMSGGPGGDMGGPGGSSSSSVTSLFSGS
KGGGISSFYPVIGAVIILIAGIVLWKKRKWILLKLNKKQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]