dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|111017519|ref|YP_700491.1| (Rhodococcus jostii RHA1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein RHA1_ro00497 [Rhodococcus jostii RHA1]
Sequence length 122
Sequence
MQTLQPIFDKREQLAQIQSGLLQGESVIAVYDCIGTGTGFVALTDRRVILQDRSFVGNKT
AITSIPYGKIRSVSVVSNKSWAGAFFSGGSIAIDAGKVHTAEFRGMDKSRHVHDVILWHI
TR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]