dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|568151573|ref|YP_008940520.1| (Pseudomonas aeruginosa LES431)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein T223_01980 [Pseudomonas aeruginosa LES431]
Sequence length 98
Sequence
MSFYRWDGEDLLLDCHLQPKASRDEFAGLHGERLKIRLTAPPVEGKANAHLLAFLGKAFG
VAKSLVSLESGELNRQKRVRIRHPTRLPEELGIAARPA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]